(data stored in ACNUC29543 zone)

EMBL: CT978603.CYSH

CT978603.CYSH        Location/Qualifiers
FT   CDS_pept        370160..370876
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="SynRCC307_0390"
FT                   /product="Phosphoadenosine phosphosulfate reductase (PAPS
FT                   reductase)"
FT                   /EC_number="1.8.4.8"
FT                   /note="Amino acid transport and metabolism / Coenzyme
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27293"
FT                   /db_xref="GOA:A5GQY4"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY4"
FT                   /protein_id="CAK27293.1"
FT                   /translation="MQLVQDLEATQAELEALEAPEQLRWANDHFGSGFAVTTSFGTQSA
FT                   VLLHLLVAVAPDVPVYWIDTGYLFPETYQYAADLTQRLKLNLKVVQPELSPARMEALLG
FT                   RLWESENPDDLVTYHRLRKVEPLDQALDAAEVSCWASGVRAGQTDNRAAMRPLERLRGR
FT                   WSLRPLLRWTRRDVYYYMEKHELPQHPLFEQGYSTVGDWHSSAPDDGLGRASRFGGRHQ
FT                   ECGLHLPEPLVEGAGI"
     gtgcagctgg ttcaggatct ggaagccacc caggctgagc tggaggcgct tgaggcccct        60
     gagcaattgc gctgggccaa tgatcatttc ggcagcggct ttgctgtcac caccagcttt       120
     ggcacccagt cagccgtttt gctgcatctg ttggtggctg tggcgccaga tgtgcccgtc       180
     tactggattg atacggggta tctattccct gagacctacc aatacgccgc ggatttaacg       240
     cagcgcctca agctgaatct caaggtggtg cagcctgagt tgagcccagc gcgcatggaa       300
     gcgctgctcg gccggctttg ggagagcgaa aaccccgacg acctggtgac ctaccaccgg       360
     ctgcgcaagg tggagccctt ggatcaggcc ttggatgctg ctgaggtgag ctgctgggct       420
     agcggtgtgc gggctggtca aactgataac cgcgccgcca tgcggccgct ggagcgtttg       480
     cgcgggcgtt ggagtttgcg gccgctgctg cgctggaccc ggcgcgacgt ctactactac       540
     atggagaagc acgagctgcc tcaacatccc ctgttcgagc agggctacag caccgtgggt       600
     gactggcact ccagtgcacc cgacgatggt ttgggtcggg ctagccgctt tggcggtcgc       660
     catcaggagt gcggcttgca tctgccggaa cctttggtgg aaggcgccgg gatttga          717
//

If you have problems or comments...

PBIL Back to PBIL home page