(data stored in ACNUC29543 zone)

EMBL: CT978603.DNAX

CT978603.DNAX        Location/Qualifiers
FT   CDS_pept        complement(57862..59676)
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="SynRCC307_0063"
FT                   /product="DNA polymerase III gamma/tau subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26966"
FT                   /db_xref="GOA:A5GQ07"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ07"
FT                   /protein_id="CAK26966.1"
FT                   /translation="MAYEPLHHKYRPQRFDQLVGQEAIAATLSQALQRGRIAPAYLFSG
FT                   PRGTGKTSSARILARSLNCLSSDGPTAEPCGTCELCTAIAAGGALDVIEIDAASNTGVD
FT                   NIRDLIERSRFAPVQARWKVYVVDECHMLSTAAFNALLKTLEEPPPRVVFVLATTDPQR
FT                   VLPTILSRCQRFDFRRIPLQALEQHLLWIAEQEAINITPEAVHLVAQLAQGGLRDAESL
FT                   LDQLSLLPPPVEPEAVWELLGAVPEQELLQLAAALQASDPLDLLQSCRQLLDRGREPAA
FT                   VLQGLAGLLRDLVLALAAPQHLELTSFSPANREALPALAQQLGRARLLRWQEGLRGSEV
FT                   QLRQSAQPRLWLEVLLLGLLAEPQAAAIAAAPAPIAQAATPAPAPPAAAAVPVPAPVAE
FT                   PAAAPAPAASTTPAAEPTSAPAPAAANLDLNSLWQQILASLELPSTRMLLTQQGELVRL
FT                   DNQRAVVRVAPNWAGMVQSRLPLLEQAAAKVLGQPRQVVLETGEPSQQKQPPQPAAPAP
FT                   VASPEAPPANPKPAAVAPTPPPEAPATTPAAPPTAAATPTPAAEPPAAPPKEVPAPPLP
FT                   ASSGQLEQQAKRFADFFDGAVVSDDTAA"
     atggcctacg aaccgctgca ccacaagtac aggccccagc ggtttgatca gcttgttggc        60
     caagaagcca tcgccgccac cttgagccag gcgctgcaac ggggccggat cgctccggcc       120
     tatctattca gtggcccacg cggcaccggc aaaacctcca gcgcccggat cctggcgcgc       180
     tcgctgaatt gcctcagcag tgacggaccg accgctgaac cctgcgggac atgcgaactc       240
     tgcaccgcaa tcgccgctgg tggcgccctt gatgtcatcg aaatcgacgc cgcctccaac       300
     accggtgtcg acaacattcg cgacctaatc gagcgctcgc gctttgcacc ggtgcaggcg       360
     cgctggaagg tctatgtggt ggatgaatgc cacatgcttt ccaccgcagc gttcaacgcc       420
     ctgctcaaaa ccctcgagga gccgccaccg cgggtggtgt ttgtgctggc caccaccgat       480
     ccccagcggg tgttgccaac gatcttgagc cgctgccagc gctttgattt ccgccgcatc       540
     cccctgcagg cgctcgaaca acacctgctt tggattgctg agcaagaagc catcaacatc       600
     accccagagg cggtgcacct ggtggcccag ctggcccaag ggggcctcag ggacgctgag       660
     agcttgctgg atcaactcag cctgctgccg ccgcctgtgg aacccgaagc ggtgtgggaa       720
     ctgctgggtg ccgtcccgga gcaggagctg ctgcagctgg cagcagccct gcaagcctcc       780
     gacccattgg atttactgca gagctgccgc cagctgctgg atcgcggccg cgaaccagct       840
     gcggtgctgc aaggcctggc tggcttgctg agggatctag tactcgctct ggcggcccca       900
     caacatttgg agctcaccag cttctccccg gccaatcgcg aggcgctgcc agcactggcc       960
     caacaactcg ggcgtgcacg cctattgcgc tggcaggagg gcttgcgcgg cagcgaggtg      1020
     caactgcgtc aaagcgctca gccgcggctg tggctcgaag tgttgctgct gggcctgctg      1080
     gctgaacccc aagccgctgc catcgctgca gctccagccc cgattgccca agcagccact      1140
     ccagctccag cgcctccggc cgccgccgcc gttccggtgc ccgctcctgt cgctgagccg      1200
     gcagcagccc ctgcaccagc ggccagcacg acgccagctg cagaacccac ttctgctccc      1260
     gccccggcag ccgccaatct cgatctcaac agcctctggc agcagatcct ggccagcttg      1320
     gagctcccct ccacacgcat gctgctgacg cagcaagggg agctggtccg cctcgataac      1380
     cagcgggccg tggtgcgcgt ggcccccaat tgggccggca tggtgcaaag ccgcctgcct      1440
     ctgctggagc aggctgccgc caaagtgctc ggtcaacccc gccaggtggt gctggaaacc      1500
     ggcgaaccca gtcagcaaaa gcagccgcca caacctgccg cgcctgctcc agtggcttca      1560
     ccggaggcgc caccggctaa ccccaagcca gcggccgttg ccccaacacc accaccagaa      1620
     gctccggcaa ccacgccagc cgcacctcca acggcggcag ccacgccaac accggctgcg      1680
     gaacctccag ctgccccccc caaagaggta ccggctccac cgctaccggc cagtagcggt      1740
     caactggagc aacaggccaa gcgctttgct gatttcttcg atggtgccgt cgtcagcgac      1800
     gacaccgcgg cctag                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page