(data stored in ACNUC29543 zone)

EMBL: CT978603.DPPC

CT978603.DPPC        Location/Qualifiers
FT   CDS_pept        504385..505257
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="SynRCC307_0569"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, permease component"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27472"
FT                   /db_xref="GOA:A5GRG3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG3"
FT                   /protein_id="CAK27472.1"
FT                   /translation="MASLWLQRFWTWRPRSLSARLARVGLWVLLFYVLIALISPVLFGI
FT                   GLLPDVNTGLENEINAPPSLEHWCGTNRLGQDVCARTIAGAGVALKVVVLALTLALIVG
FT                   VPLGMLSGYFGGPVDRALVLLMDTVYSLPVVLLAVVMAFLLGQGLLNAAAALCVVYVPQ
FT                   YFRVVRNQTASVKAELFVEAAQSLGAGPVWIMRKYLFRNVITSVPVVLTMNAADSVLML
FT                   GSLGFLGLGLPAVVPEWGAELKQALTALPTGIWWTALYPGVAMFILVLALSFIGEGLDA
FT                   WVSGDEARP"
     atggcatccc tctggctgca acgcttctgg acctggcgtc cgcggtccct ttcagcccgc        60
     ttggcccgcg tgggcctgtg ggtgctgctc ttttatgtgc tgattgccct gatcagccca       120
     gtgctctttg gcattggcct gctgccggat gtgaacaccg gcctggagaa cgagatcaat       180
     gcgccgccct cgctggagca ctggtgcggg accaatcgtt tgggtcaaga cgtttgtgct       240
     cgcaccattg ctggcgccgg tgtggcgctg aaggtggtgg tgctggcgct caccttggcc       300
     ttgatcgttg gtgtgccgct ggggatgctc agcggttatt tcggtgggcc ggtggatcgt       360
     gccttggtgc tgctgatgga caccgtgtat tcgctgccgg tggtgctgct ggcggtggtg       420
     atggcgtttc tgttgggtca ggggctgctt aatgccgccg cagcgttgtg cgtggtttat       480
     gtgccgcagt acttccgcgt cgtgcgcaac caaacggcct cggtgaaagc cgaactgttt       540
     gtggaagcgg ctcagagcct gggtgctggg ccggtgtgga tcatgcgcaa atacctgttc       600
     cgcaacgtga tcacctcggt gccggtggtg ctcaccatga atgcggcgga ttcagtgttg       660
     atgctgggca gccttggttt tttgggcctg ggcctgccgg ccgttgttcc cgaatggggc       720
     gctgagctca agcaggcgct cacggcgctg cccaccggga tctggtggac cgcgctctac       780
     cccggggtgg ccatgttcat cctggtgctg gcgctctcat tcattggcga aggccttgat       840
     gcttgggtga gcggcgatga agccaggccc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page