(data stored in ACNUC29543 zone)

EMBL: CT978603.FABG

CT978603.FABG        Location/Qualifiers
FT   CDS_pept        complement(616124..616876)
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SynRCC307_0681"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="Lipid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27584"
FT                   /db_xref="GOA:A5GRS5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRS5"
FT                   /protein_id="CAK27584.1"
FT                   /translation="MSSLAPLAGQIALVTGASRGIGRAIALQLAEAGAEVVVNYASSAD
FT                   AAEQVVSAITAAGGSAYALKADVSQEDQVEQLMAAVLEKSGRIDVLINNAGITRDGLLM
FT                   RMKTPDWQAVLDLNLSGVFLCTRAVTRTMLKQKQGRIINITSVVGLMGNAGQANYAAAK
FT                   AGVIGFTKSTARELASRGITVNAVAPGFIATDMTKDLAAEALLNAIPLGRYGEVDEVAG
FT                   AVRFLAADPAAAYITGQVLQVDGGMVMA"
     atgagttcat tggcacccct ggccggccaa atcgccctgg taacgggcgc tagccgcggc        60
     atcggccgtg ccatcgccct gcaactggct gaagccggcg ctgaagtcgt ggtgaactac       120
     gccagctctg ccgacgctgc cgagcaggtg gtgagcgcga tcaccgccgc tggcggcagc       180
     gcttacgccc tcaaggctga tgtcagccaa gaagaccagg tggagcagct gatggcagcc       240
     gttttggaga aaagcggccg catcgatgtg ctgatcaaca acgccggaat cacccgcgat       300
     ggtctgctga tgcggatgaa aaccccggac tggcaggcgg tcttggatct caatctctcg       360
     ggtgtgttcc tctgcacccg ggcggtgacc cgcacgatgc tcaagcaaaa gcaggggcga       420
     atcatcaaca tcacttcagt ggtggggctg atgggcaacg ccggacaggc caactacgcc       480
     gccgccaagg ccggagtgat cggcttcacc aaaagcaccg cgagggaact cgccagccgt       540
     ggcatcactg tcaatgctgt agcccctggt ttcattgcca ccgacatgac caaggaccta       600
     gccgctgaag ccctgctcaa tgccattccc ctcggccgct acggcgaagt cgatgaggtg       660
     gcgggtgccg tgcgcttttt ggctgctgat ccagccgcgg cctacatcac cggccaggtg       720
     ctgcaggtgg acggtgggat ggtgatggcc tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page