(data stored in ACNUC29543 zone)

EMBL: CT978603.GRPE

CT978603.GRPE        Location/Qualifiers
FT   CDS_pept        23976..24716
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SynRCC307_0021"
FT                   /product="Molecular chaperone GrpE, heat shock protein"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26924"
FT                   /db_xref="GOA:A5GPW5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW5"
FT                   /protein_id="CAK26924.1"
FT                   /translation="MIQGSASQQHGRTARVAPMTAEPPTSPSPSEAEVSVEDQQQPMAE
FT                   AQVEQPAADAAAAEPETTAEAPEATAESGDGAAALEAELTALRQEHETVRSQYMRIAAD
FT                   FDNFRKRQQRDAEDLKLQLTCSTLGEILPVVDNFERARQQLNPEGEEAQALHRSYQGLY
FT                   KQLVDVLKQLGVSPMRVEGEPFDPTLHEAVLREPSDAHSEDVVMEELQRGYHLDGRVLR
FT                   HAMVKVSMGPGPAAAPESAPAEGN"
     ttgatccagg ggtcggcgtc ccagcaacat ggcaggactg cacgcgttgc cccgatgacc        60
     gccgagcctc ctacttcccc ctctccctcc gaggctgaag tcagcgtgga ggatcagcaa       120
     caacccatgg ctgaggctca agtcgagcag cctgccgctg acgctgctgc agcggagcca       180
     gagaccactg ctgaggcccc tgaagccacg gctgagagcg gtgatggcgc ggctgctttg       240
     gaggctgagc tcacggcttt gcgccaggaa cacgagaccg tgcgcagtca atacatgcgc       300
     atcgcggctg atttcgacaa cttccgcaag cgccagcaac gggacgctga agatctcaag       360
     ctgcagctca cctgcagcac cctcggcgag atcttgcctg tggtcgacaa ctttgagcgg       420
     gcccgtcagc agttgaatcc tgagggtgaa gaggctcaag ccctgcaccg cagttatcag       480
     gggctctaca agcagctggt ggatgtgctc aagcagctgg gtgtctcgcc catgcgcgtg       540
     gaaggtgaac cctttgatcc caccctgcac gaggccgtgc tgcgggagcc cagcgatgcc       600
     cattccgaag atgtggtgat ggaagagctg cagcggggtt atcacctcga tggccgcgtg       660
     ctgcgccacg ccatggtcaa ggtgtcgatg ggtccaggtc ccgcggcggc cccggagtca       720
     gctccggctg agggcaactg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page