(data stored in ACNUC29543 zone)

EMBL: CT978603.GST

CT978603.GST         Location/Qualifiers
FT   CDS_pept        282898..283650
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="SynRCC307_0283"
FT                   /product="Glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27186"
FT                   /db_xref="GOA:A5GQM7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM7"
FT                   /protein_id="CAK27186.1"
FT                   /translation="MELFQFRHSAFCEKVHLLLAAKGLSYSVNDVTPGVGQIELFQLTG
FT                   QRQVPVLRDGEQLIADSSAIAMHLESKHPEPALLPSDAAQRAEVLLLEDWADTALASSA
FT                   RMALLQGAAEDPVLRGALLPDATPALLRNLIGAVPGDLLGGVGQLLPMGRDSLIFALEQ
FT                   LLTLLEQRPYLVGERPTVADVAVAAQLYLLRFPSVAGPQLASRGVAGVADQPRFEPLFQ
FT                   WRDELYRTLGRRPDGSEASAPVEAMPVG"
     atggagcttt ttcagttccg ccactctgcc ttttgcgaaa aagtgcactt gttattggcg        60
     gcaaagggac tcagctacag cgtcaacgat gtcacccccg gcgtggggca gatcgagcta       120
     tttcagctca caggccagcg gcaggtgccg gtgctgcgcg atggtgaaca gctgattgcc       180
     gattccagtg ccatcgcgat gcacttggag tccaagcacc cggagcctgc gctcctgccc       240
     agtgatgccg cccagcgcgc tgaagtgttg ttgctggagg actgggccga tacggccttg       300
     gcctcttccg cccgcatggc actcctgcag ggtgcagcgg aagatcctgt gcttcgcggc       360
     gcgctgcttc ccgatgccac cccagcgctg ctgcgcaatt tgatcggtgc cgtgccaggt       420
     gatctgctcg gtggtgtggg ccaattgctg cccatggggc gcgattcgtt gatctttgcc       480
     ctggagcagc tgctcacctt gctggagcag cgcccctatt tggtgggcga gcgccccacc       540
     gtggccgatg tagctgtggc cgcccagctg tatctgttgc ggttcccatc tgtggctggg       600
     cctcaactgg cctcccgcgg tgtggctgga gtggctgatc agccccgatt tgagccgctg       660
     ttccaatggc gcgatgagct ctaccgcacc ctgggccgcc ggcccgatgg ctcagaagcg       720
     tcggctccgg ttgaggccat gccggtgggg tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page