(data stored in ACNUC29543 zone)

EMBL: CT978603.GYRA

CT978603.GYRA        Location/Qualifiers
FT   CDS_pept        complement(5970..8432)
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="SynRCC307_0005"
FT                   /product="DNA gyrase/topoisomerase IV, subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26908"
FT                   /db_xref="GOA:A5GPU9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPU9"
FT                   /protein_id="CAK26908.1"
FT                   /translation="MADERIVSISLHQEMQRSYLEYAMSVIVGRALPDVRDGLKPVQRR
FT                   ILFAMHELGLTPDRPYRKCARVVGDVLGKYHPHGDQAVYDALVRLVQTFGCRNPLLDGH
FT                   GNFGSVDDDPPAAMRYTETRLAPVSHQALLEEIGSDTVDFAPNFDGSQQEPTVLPAQLP
FT                   FLLLNGCTGIAVGMATSIPPHNLGEVVDALVALIRNPNLSDEKLLQLVPGPDFPTGGVV
FT                   LTGSGLRDTYLHGRGSIPMRGVAHIEEVQPGKGRHKRNAVVITELPYQLSKAGWIEKLA
FT                   EQVNDGKVAGIADIRDESDRDGMRVVVELRRDANPEQVLAQLHKRTALQNNFGAILLAL
FT                   VNGQPIQLSLRQMLQQFLEYRELTMMRRTRYALRRCEERLEVVEGLIKALDDLAKVIQM
FT                   IQDARDAASAKASLQVHLDISERQADAVLSMPLRRLTGLEQESLRQELEELRQEQSRLR
FT                   HLLDDRKSLLDTLVSELKHLRKRYATPRRTALQEGGDELVAQRTAAQRPNTEMLRKQAL
FT                   ANVSSDQQLLWQSDGILRLVTPQVLGRLHLLDDLDFGDHGCSAKLLLPVQPEPQLLAFT
FT                   SGGRVAALRWEFAAQQPGPLERFLPDSVDGQAEQVVDVLVVPPADQDFSVGLLSSDGRF
FT                   KRLAGQDLRELSGRATTVLKLKDGVQLQRVVMCRPGDDLAVASSTGRMLRLPVDDSTIP
FT                   VMGRTAQGPVLMRLLPGESIVGAAAVAAGGDVLLISQLGQLKRLGIDHLRRCQRGAIGE
FT                   IGLRFEQRNDALTDLRSTTARLSVETQAGSLRLASDSLPVQDGRGTGQQLKLPKGQTVQ
FT                   RLLPLIDG"
     atggcggacg agcgcatcgt ttcgatctcc ctgcatcagg agatgcagcg ctcgtatctc        60
     gagtacgcga tgagcgtgat cgtggggcgg gcgctgccag atgtgcgcga cggcctcaag       120
     ccggttcagc ggcggattct gtttgcgatg cacgagctgg gtctgacccc agatcgcccg       180
     taccgcaagt gcgcccgtgt ggtgggcgac gtgctcggca agtaccaccc ccatggtgat       240
     caggcggtct acgacgcctt ggtgcgtctg gtgcagacct tcggctgccg caatccgctg       300
     ctggatggac atggcaactt cggctcggtg gatgacgatc caccggccgc aatgcggtac       360
     accgaaaccc gcttagcgcc ggtctcccat caagccctgc tggaagagat cggcagcgac       420
     actgtcgact tcgcccccaa cttcgacggc tcccaacagg aacccacggt gctgccggcg       480
     cagctgccct tcctgctcct gaatggctgc acgggcatcg ccgtgggcat ggccaccagc       540
     attcctcccc acaacctcgg cgaagtcgtg gatgccttgg tggccctgat ccgcaacccc       600
     aacctcagcg atgagaagtt gctgcagctg gtgcctgggc ctgatttccc caccggtgga       660
     gtggtgctca ccggcagtgg attgcgcgac acctacctcc atggccgcgg cagcatcccg       720
     atgcgggggg tggcccatat cgaggaggtg caacccggca aaggacgcca caagcgcaat       780
     gcggtggtga tcaccgagct gccctatcaa ctcagcaagg ccggctggat tgaaaaactg       840
     gcggaacagg tcaacgacgg caaagtcgct ggcatcgccg acatccgcga tgaaagtgat       900
     cgcgacggca tgcgggtggt tgtggaactc cgccgcgatg ccaaccctga acaagtgctg       960
     gcgcagctgc acaaacgcac agccctgcaa aacaatttcg gcgccatctt gctggcgcta      1020
     gtcaatggcc aacccatcca gctgagcctg cgccagatgc tccagcagtt cctggagtac      1080
     cgcgaactca cgatgatgcg gcgcacccgt tatgccctgc gccgctgcga agaacgcctg      1140
     gaagtggtgg agggtctgat caaagccctc gatgacctgg ccaaggtgat ccaaatgatt      1200
     caggacgccc gcgatgccgc cagcgccaaa gccagcctgc aggtgcacct cgacatcagc      1260
     gaacggcaag ccgacgccgt tctctccatg cccctgcgcc gcctcaccgg cctcgagcag      1320
     gaaagcctgc gccaggaatt ggaggaatta cgtcaagagc agagccgcct gcgtcacctg      1380
     ctcgatgacc gcaaatcgct gctcgacacc ctggtcagtg agctgaagca cttgcgcaag      1440
     cgctatgcca ccccacggcg gacagcgctg caagaagggg gggatgagct ggtggcgcag      1500
     cgcaccgcag cccagcggcc caacactgaa atgctgcgca agcaagcgct ggccaacgtc      1560
     agcagcgatc aacagctgct atggcaaagc gacggcatcc tgcgactggt aactccccaa      1620
     gtgctgggcc ggctgcacct gctcgacgac ctggactttg gcgatcacgg ctgcagcgcc      1680
     aagttgctgc tgccggtgca accggaacca caactgctgg ccttcaccag cggtggccgc      1740
     gttgcggcgc tgcgttggga atttgcggca cagcagcccg gccccttgga acgcttcttg      1800
     cctgacagcg tcgatggcca agctgaacag gtggtggatg tactggtggt gcccccagcc      1860
     gatcaagact tcagcgttgg tttgttgagc agcgatggcc gcttcaagcg ccttgctggc      1920
     caagacctcc gggagctatc cggacgcgcc accaccgtgc tcaagctcaa ggacggcgtg      1980
     cagctgcagc gggttgtgat gtgccggcct ggcgatgatc tagcggtggc cagcagcacg      2040
     ggccgcatgc ttcgcctgcc cgttgatgac agcaccatcc cggtgatggg acgcacggcc      2100
     caaggtccgg tgttgatgcg cttgctgcca ggcgaatcga ttgtgggagc cgcggctgtg      2160
     gccgccggag gcgatgtgct gctgatcagc cagttgggcc agctcaaacg cctcggaatc      2220
     gaccatctac gccgctgcca gcggggcgcc attggcgaaa tcggtctgcg ctttgagcag      2280
     cgcaacgacg ccctcaccga tctgcgcagc accacagcgc ggctcagcgt ggaaacccaa      2340
     gccggcagcc tgcgtttggc cagcgactca ctgcctgtgc aagatggccg cggcactggt      2400
     caacagctca agctgcccaa aggccaaacc gtgcaacggc tattgcccct gatcgacggc      2460
     taa                                                                    2463
//

If you have problems or comments...

PBIL Back to PBIL home page