(data stored in ACNUC29543 zone)

EMBL: CT978603.HUP

CT978603.HUP         Location/Qualifiers
FT   CDS_pept        447626..447901
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="SynRCC307_0481"
FT                   /product="DNA-binding protein HU"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27384"
FT                   /db_xref="GOA:A5GR75"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR75"
FT                   /protein_id="CAK27384.1"
FT                   /translation="MNKADLVNLVAARTELTKTDVSQVVDAAIETIIDSVVEGKKVSIL
FT                   GFGSFESRERSARQGLNPKTGEKIAIPAKKVPAFTAGKMFKDRVQG"
     atgaacaaag ctgatctggt caacctggtt gcagctcgta ccgagctgac caaaaccgac        60
     gtctcccagg tggttgacgc tgccattgaa accatcatcg attccgtcgt tgaaggcaaa       120
     aaagtttcca tccttggttt cggctccttt gaatcccgtg agcgttctgc tcgtcagggc       180
     ctgaacccca agaccggcga aaagatcgcc atccccgcca aaaaggttcc cgccttcacc       240
     gccggcaaga tgttcaaaga tcgcgtgcag ggctga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page