(data stored in ACNUC29543 zone)

EMBL: CT978603.ILVC

CT978603.ILVC        Location/Qualifiers
FT   CDS_pept        complement(528422..529417)
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="SynRCC307_0594"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="Amino acid transport and metabolism / Coenzyme
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27497"
FT                   /db_xref="GOA:A5GRI8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRI8"
FT                   /protein_id="CAK27497.1"
FT                   /translation="MATLYYDTDADLGLLSGKTVAIIGYGSQGHAHALNLKDSGVDVVV
FT                   GLYEGSRSADKAKADGLEVLSVADAAAKADWIMVLLPDEFQKEVYDKEIAPHLSAGKVL
FT                   SFAHGFNIRFGLIKPPADVDVVMIAPKGPGHTVRWEYQNAQGVPALFAIEQDASGNARG
FT                   LAMAYAKGIGGTRAGILETNFKEETETDLFGEQAVLCGGLSELVKAGFETLVEAGYQPE
FT                   LAYFECLHEVKLIVDLMVKGGLSAMRDSISNTAEYGDYVSGPRLITAETKAEMKRILGD
FT                   IQDGTFAKNFVAECEAGKPEMNKIRERDSAHKIEEVGKGLRAMFSWLKAA"
     atggccacgc tgtattacga caccgacgct gacctgggcc tgctcagcgg taagaccgtg        60
     gcgatcatcg gctatggctc ccaaggccat gcccacgcgc tgaacctcaa ggacagcggc       120
     gttgatgtgg tggtgggcct ctatgaaggc agccgctcag ccgacaaagc caaggccgat       180
     gggctggagg tcctgagcgt tgccgatgca gccgccaagg ccgactggat catggtgctg       240
     ctgcccgatg aattccagaa agaggtttac gacaaggaaa tcgccccgca tctgagcgcc       300
     ggcaaggtgc tgagctttgc ccacggtttc aacatccgct ttggcctgat caagcctccg       360
     gctgatgtgg atgtggtgat gatcgccccc aagggcccgg gccacacagt gcgctgggaa       420
     tatcaaaatg cccagggcgt gccggccctg tttgccattg agcaagatgc cagtggcaac       480
     gcccgcggcc tggccatggc ctacgccaaa ggcattggcg gcacccgcgc cggcatcctc       540
     gagaccaatt tcaaagaaga gaccgaaacc gacctctttg gtgagcaggc cgtgctgtgc       600
     ggcggcctct cggagctggt caaagcaggc tttgaaaccc tggtggaagc cggctatcag       660
     ccggagctgg cctacttcga gtgcctgcac gaggtgaagc tgatcgttga cctgatggtc       720
     aaagggggcc tctcggccat gcgcgattcg atctccaaca ccgctgaata cggcgactac       780
     gtgagtgggc ctcgcctgat cactgccgag accaaagcgg agatgaagcg catcctgggt       840
     gacatccagg acggcacctt cgccaagaac ttcgtcgctg aatgcgaagc cggcaagccg       900
     gaaatgaaca agatccgcga acgcgacagc gcccacaaga tcgaggaagt gggcaagggc       960
     ctgcgcgcca tgttcagctg gctcaaagca gcctga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page