(data stored in ACNUC29543 zone)

EMBL: CT978603.KPSF

CT978603.KPSF        Location/Qualifiers
FT   CDS_pept        283728..284753
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="SynRCC307_0284"
FT                   /product="Polysialic acid capsule expression protein"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27187"
FT                   /db_xref="GOA:A5GQM8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM8"
FT                   /protein_id="CAK27187.1"
FT                   /translation="MNPLAPVLQQEAQALLNTAAQLRPDQAEAALDLLQHCSEQGAKLV
FT                   VTGVGKSGIVARKIAATFTSIGLMALYLNPLDALHGDLGVVGAEDVVLLLSNSGESSEL
FT                   LALLPHLHRRGSACIALTGRLDSSLARGAQVVLDGSVDREVCPLNLAPTASTAVAMAIG
FT                   DALAAVWMQRQGITQADFAVNHPAGSLGRQLTLSVADLMVPIDTCPPLPPDAALPEVVD
FT                   QLTGALAGAAWVQQPDQPKRLLGLITDGDLRRALRTHSPQAWASIQAADLMTTDPITAA
FT                   PDQLAVAALELMERNRRKSISVLPVQAVSGELVGLLRLHDLVQAGLSRASGTTTDIPQA
FT                   A"
     atgaatcccc tggccccggt gttgcagcag gaagcccagg cgttgttgaa cacggccgct        60
     caattgcggc ccgatcaagc cgaggccgcc ttggatctgc tgcagcactg cagcgagcag       120
     ggcgccaagt tggtcgtcac gggtgtgggc aaaagcggga tcgtggctcg caagatcgcg       180
     gccacgttca cctcgattgg cctgatggcc ctctatctca atcccctcga tgcactgcat       240
     ggggatctgg gggttgtggg ggccgaagac gttgttctgc tgctctccaa cagcggcgag       300
     agcagtgagt tgctggcgtt gctgccccat ttgcaccgcc gcggtagcgc ttgcattgct       360
     ctgacgggcc ggctggattc cagcttggcc aggggcgctc aagtggtgct cgatggctcc       420
     gtggatcgtg aggtgtgccc cctcaacctg gctccaacag ccagcacagc agtggcgatg       480
     gcgattgggg atgccttggc ggcggtgtgg atgcagcggc agggcatcac ccaggccgat       540
     tttgcggtga atcaccccgc aggttccttg gggcggcagc tcaccctcag cgtcgcggat       600
     ttgatggtcc ccatcgacac gtgcccgccc ttgccgccgg atgctgcatt gccagaagtg       660
     gtggaccagc tcaccggcgc tctggctggg gccgcgtggg tgcagcagcc tgatcagccc       720
     aagcggttgt tgggcttgat caccgatggc gacctgcgcc gcgcgctgcg aacccattcg       780
     ccccaggcct gggcttcgat tcaggcggcc gatttgatga ccactgatcc catcacggca       840
     gcccctgatc aattggccgt tgccgctttg gagctgatgg agcgcaaccg ccgtaagtcg       900
     atttcggtgt tgcctgtgca ggcggtcagt ggggagttgg tggggctgct gcgcttgcat       960
     gatctggtgc aggccgggct gagccgcgct tcaggaacca caacagacat tccgcaggcg      1020
     gcatga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page