(data stored in ACNUC29543 zone)

EMBL: CT978603.LYSC

CT978603.LYSC        Location/Qualifiers
FT   CDS_pept        complement(72639..74441)
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="SynRCC307_0075"
FT                   /product="Aspartokinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26978"
FT                   /db_xref="GOA:A5GQ19"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ19"
FT                   /protein_id="CAK26978.1"
FT                   /translation="MALLVQKYGGTSVGSVERIQAVAKRVAAARLDGHDLVVVVSAMGH
FT                   TTDELTALARALNPDPPQREMDMLLATGEQVSIALLSMALQAEGVAATSMTGPQVGIVT
FT                   ESAHGRARILEVRTERVKRRLHDGHVVVVAGFQGTSTGSAGTPEITTLGRGGSDTSAVA
FT                   LAAALGADACEIYTDVPGVLTTDPRKVPEAQLMTQVSCDEMLELASLGAAVLHPRAVEI
FT                   ARNYGVPLIVRSSWSDEPGTRLFSQPSRRIGSEGLELGKPVDRAELLEGQAVVALAHVP
FT                   DEPGVAARLFEGLGAAGLNVDLIVQATHDGSSNDIAFTLAEAELPAAEAFCREHLGEGS
FT                   QLQVQSGLAKLSIGGAGIMGRPGVAAQLFDGLSKMGISLRMIATSEVKVSCLIQGEQAA
FT                   KALRTAAQVFELDDHQLQHNPLPGGEGEPDVRGVALDRDQAQLTVTAVPDRPGSAAALC
FT                   RALADGGISLDTIVQSERQRQTDLGLCRDIAFTLPRDDLSRASEALRPLLKLWPGAELV
FT                   EGKAIARVSAVGAGMPSTPGSAAKMFRALADAGINIEMIATSEIRISCVVPEDDGIGAL
FT                   QAVHQAFGLNGESQHQAQGSEWAG"
     atggcgctgc tggttcagaa atacgggggc acctccgtgg gcagcgtgga gcgcatccag        60
     gccgttgcta agcgcgtcgc tgcagctcgc ctcgatggcc atgacctggt ggtggtggtc       120
     tccgcgatgg gccacaccac cgatgagctc acagccctgg cccgagccct caatcccgat       180
     cccccccaga gggaaatgga catgctgctg gccaccggtg agcaggtgtc gattgccttg       240
     ctctcgatgg cccttcaggc cgaaggcgtt gcagctacat cgatgacggg gccccaggtg       300
     gggatcgtca ccgagtcggc ccatggccgc gcccggatct tggaagtgcg caccgaacgg       360
     gtcaaacgcc ggctgcacga tggccatgta gtggtggtgg ctggctttca aggcaccagc       420
     accggcagcg cgggaacccc ggaaatcaca accctgggcc gcggaggctc ggacacatca       480
     gcggtggcct tagcggcagc actgggagct gatgcctgtg agatctacac cgacgtgccg       540
     ggtgtgctga ccaccgatcc ccgcaaggtg ccggaagccc agctgatgac tcaggtgagc       600
     tgcgatgaaa tgttggaact ggccagcctg ggtgcggctg ttctgcaccc aagggcggtg       660
     gaaatcgcca gaaactacgg cgttcctctg atcgtgcgat ccagttggag cgacgagcca       720
     ggaacacgcc tgtttagtca accgagccgg cggattggca gtgaaggatt ggagctgggc       780
     aaacccgtgg accgagcaga actgctggaa ggccaagccg tggtggccct ggcccatgtg       840
     cccgatgaac ccggggtagc cgctcgcttg tttgaagggc tcggcgccgc tggtctgaac       900
     gtcgacctga tcgtgcaagc cacccacgac ggcagcagca atgacatcgc cttcaccctg       960
     gcggaggctg agctgccggc cgctgaggcc ttctgccgcg agcacctagg agagggaagt      1020
     cagctgcagg tgcaaagcgg gctcgccaaa ctcagcattg gcggtgccgg gatcatgggg      1080
     cgacctggag ttgccgccca actgtttgac gggctcagca agatgggcat cagcctgcgc      1140
     atgatcgcca ccagcgaggt gaaggtgagc tgcctgattc agggcgaaca agccgccaaa      1200
     gccctgcgca ctgctgctca agtgtttgaa ctggatgacc accagctcca gcacaacccc      1260
     ttaccgggtg gggaagggga gcctgatgtg cgaggtgtgg ccctcgatcg cgatcaagcc      1320
     caactcacgg tgaccgccgt accggatcgc ccgggatcag cggcggcact ctgccgggcc      1380
     ttggccgatg gcggcatcag cctcgacacc atcgtgcagt ccgagcgtca acgccaaacc      1440
     gatctggggc tctgccgcga cattgctttc acgctgccgc gagacgatct gagccgagcc      1500
     agtgaggccc tgcggccctt gctcaaactc tggcctggtg ctgagctcgt tgaaggcaag      1560
     gcgattgccc gggtcagtgc cgtcggagct ggcatgccct caacgcctgg cagtgccgcg      1620
     aaaatgttcc gggccttagc ggacgctggg atcaatatcg agatgatcgc cactagcgaa      1680
     atccgcatca gttgcgtggt gcctgaagac gatggaatcg gtgctctgca agccgtgcac      1740
     caggcctttg gcctcaatgg ggagagccaa catcaagccc aaggcagcga atgggccggc      1800
     taa                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page