(data stored in ACNUC29543 zone)

EMBL: CT978603.MINC

CT978603.MINC        Location/Qualifiers
FT   CDS_pept        complement(415321..416001)
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="SynRCC307_0441"
FT                   /product="Septum site-determining protein MinC"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27344"
FT                   /db_xref="GOA:A5GR35"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR35"
FT                   /protein_id="CAK27344.1"
FT                   /translation="MVARLDPAPAPGWPHRLQLGDWQAGADPCEAVLHALGADPPQGRV
FT                   VMEAGPWPLQCSHLQAIAQHLEQAGLQLEELSSSEPSTLVASAALGLRSQAEPPAPQNA
FT                   EEPKGTGRELHVHRGTVRAGEHLEVDGAVLVLGDVNPGARISARGDVLIWGRLRGIAHA
FT                   GCHGARNARIVALQLRPLQLRIADAVARGPEEPPPEGVTEQARLEGDEIAISAAQLGVP
FT                   ISWG"
     atggtcgccc gcctagaccc tgcccccgct ccgggctggc cccaccggct gcagctgggc        60
     gattggcaag cgggggctga tccttgtgaa gcggtgctgc atgcccttgg cgccgacccg       120
     ccccagggcc gggtggtgat ggaggccggt ccctggcctt tgcaatgcag ccatctgcag       180
     gcgattgctc agcacctcga gcaagccggt cttcaactcg aggagctgag cagcagcgag       240
     cccagcacct tggtggcctc agcagctctg gggctgcgca gccaggccga accaccagct       300
     cctcagaacg ctgaagagcc caagggcact gggcgcgagt tgcacgtcca ccgcggcacc       360
     gtgcgcgccg gcgaacatct ggaagtggat ggcgcggtgc tggtgctggg cgatgtgaat       420
     cctggtgcgc gcatcagcgc ccgcggtgat gtgttgattt gggggcggct gcgcggcatt       480
     gcccatgccg gatgccacgg cgcccgcaac gcgcgcatcg tggcgctgca actgcggccg       540
     ctgcagttgc gcattgccga tgccgtggcg cgcggcccgg aagaaccgcc gccggaagga       600
     gtcaccgagc aagcgcggct cgagggcgat gagattgcaa tcagtgccgc ccaattaggg       660
     gtgccgatca gctggggatg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page