(data stored in ACNUC29543 zone)

EMBL: CT978603.MIND

CT978603.MIND        Location/Qualifiers
FT   CDS_pept        complement(412259..413077)
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="SynRCC307_0437"
FT                   /product="Septum site-determining protein MinD"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27340"
FT                   /db_xref="GOA:A5GR31"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR31"
FT                   /protein_id="CAK27340.1"
FT                   /translation="MTGSSTRTILICSGKGGVGKTTLTANLGIALASQGVRTAVLDADF
FT                   GLRNLDLLLGLENRIVYTAQEVLAGNCRLEQAMVKHKLQPNLALLPAGNPRMLEWLKPE
FT                   DMQKIVGLIQPHFDVVLIDAPAGIEDGFKNAAAAADEAIVVTTPEVSAVRDADRVIGLL
FT                   NTRGVEPIQLVLNRVRPKMMQSQEMLGVTDVTDILALPLLGLVFEDEQVIVSTNRGEPL
FT                   TLNGSSSPAAIAYRNVAKRLQGEEVPLPDPTKQRRGLRAKMRQLMQTKLF"
     gtgactggct catccactcg caccatcctg atttgctccg gcaaaggcgg tgtgggcaaa        60
     accaccttga cggccaacct cggcatcgcc ctggcatccc agggggtgcg cactgccgtt       120
     ctcgatgccg acttcggcct gcgcaacctc gacttgctgc tgggcctgga aaaccggatc       180
     gtctacaccg cacaagaagt gctcgcgggc aactgccgcc tggagcaggc gatggtgaag       240
     cacaagcttc agcccaacct ggcgctgctg cccgctggca acccacgcat gctcgagtgg       300
     ctcaagcccg aggacatgca gaagatcgtg gggctgatcc aaccccactt cgatgtggtg       360
     ttgatcgacg caccggccgg catcgaagac ggcttcaaaa atgctgctgc tgcagctgat       420
     gaagccatcg tggtcaccac cccggaggtc tctgccgtgc gcgatgccga ccgggtgatc       480
     ggcttgctta acacccgtgg ggtggagccg attcagctgg tgctcaaccg ggtgcgcccc       540
     aaaatgatgc agtcccagga gatgttgggc gtcaccgatg tcaccgacat cctggcgctg       600
     cccttgttgg gcttggtatt tgaagacgag caggtgatcg tcagcaccaa ccggggtgag       660
     cccctcaccc tcaatggctc gagctcacca gcggcgattg cctaccgcaa tgtcgccaag       720
     cgcttgcaag gcgaagaagt gccgctgccc gatcccacca aacagcgccg cggcctgcgg       780
     gccaagatgc gccaactcat gcaaaccaaa ctgttctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page