(data stored in ACNUC29543 zone)

EMBL: CT978603.MREB

CT978603.MREB        Location/Qualifiers
FT   CDS_pept        106210..107271
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="SynRCC307_0109"
FT                   /product="Rod shape-determining protein MreB"
FT                   /note="Cell division and chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27012"
FT                   /db_xref="GOA:A5GQ53"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ53"
FT                   /protein_id="CAK27012.1"
FT                   /translation="MAWHLMFWRRFQLSRDIGIDLGTANTLIYATGKGIVLREPSVVAI
FT                   DLDKGVPLAVGEEAKLMLGRTPGNIRAVRPLRDGVIADFDAAEQMIKYFIQKGNEGRGM
FT                   VAPRLVIGIPSGVTGVERRAVREAGLGGAREVHLIDEPVAAAIGAGLPVTEPVGSMIVD
FT                   IGGGTTEVAVLSLQGTVISESVRVAGDELSDSITSYLKKVHNLVVGERTAEEIKIRIGS
FT                   AFPDDEFDQTAMDVRGLHLLSGLPRTINVRAGDIREAMIEPLNVIVEAVKRTLERTPPE
FT                   LAADIVDRGIMLAGGGALVRGISDLVSNETGILTHVAEDPLLCVVNGCGRVLEDFKRLG
FT                   RVLDASEFSRLAN"
     atggcttggc atctcatgtt ttggcgtcgt tttcagcttt cccgcgatat cgggattgac        60
     ctgggcaccg ccaacaccct gatctatgcc acaggcaagg ggatcgtgtt gcgtgaaccg       120
     tcggtggttg ccatcgacct cgacaaaggc gttcctttgg cggttggcga agaagccaaa       180
     ttgatgctcg gccgcacgcc gggaaacatc cgtgcggtgc gtcccctgcg cgacggcgtc       240
     attgctgact ttgatgctgc tgagcagatg atcaagtact tcatccagaa ggggaatgaa       300
     ggccgcggca tggtggcccc ccgcttggtg atcggcatcc ccagtggcgt caccggtgtg       360
     gaacgccgtg ctgtgcgcga agccggtttg ggcggcgccc gggaagtgca tttgattgat       420
     gaaccggtgg ctgctgctat cggtgccggt ctgccggtga ccgaacccgt tggctcgatg       480
     attgttgaca tcggcggtgg caccaccgag gtggctgtgc tcagcctcca aggcactgtg       540
     atctctgaat cggtgcgcgt cgccggtgat gaactcagcg actcaatcac cagctacctg       600
     aaaaaggtcc acaacctggt ggtgggtgag cgcaccgctg aagagatcaa gatccgcatc       660
     ggctcggcct tccccgacga tgagttcgat cagaccgcca tggatgtgcg tggtctgcac       720
     ctgctctctg gtttgccccg caccatcaac gtgcgcgctg gcgatatccg cgaagccatg       780
     atcgagccgc tcaacgtgat cgttgaggcg gtgaagcgca ccttggagcg cactccccct       840
     gaactggctg ctgacatcgt tgaccgcggc atcatgctgg ccggcggcgg cgcgctggtc       900
     cgcggcatca gtgacctggt gagcaatgaa accgggatcc tcacccacgt ggcggaagac       960
     ccgctgctgt gtgtggtgaa tggctgcggc cgtgtgctgg aggacttcaa gcgcctgggc      1020
     cgtgtgctgg atgcctccga gttcagccgt ttggccaact aa                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page