(data stored in ACNUC29543 zone)

EMBL: CT978603.NDH

CT978603.NDH         Location/Qualifiers
FT   CDS_pept        complement(368948..370078)
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="SynRCC307_0389"
FT                   /product="NADH dehydrogenase, FAD-containing subunit"
FT                   /EC_number="1.6.99.3"
FT                   /note="Energy production and conversion"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27292"
FT                   /db_xref="GOA:A5GQY3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQY3"
FT                   /protein_id="CAK27292.1"
FT                   /translation="MTSPIVIVGGGFAGLYTALELARRPGHPPLLLVEPRDRFVFLPFL
FT                   YERLSGELPLWQMAPRYDALLAGHGIGWQRDRVTAVEPGSCQVVLESGQRLGYSQLVIA
FT                   TGAKPDSFGIPGVEEHALRFHSLEDVEALQAQLPAIRNRVAIVGAGPSGVELACKLADL
FT                   LRGQANVELIERGERCLPQAKAFNRSQAELALQQRDVRLRCQCGVKAVQPGELTLQDAQ
FT                   GQSSSLAVDAVVWTAGQRTALPGGTLATDGRGRLRCNASLQLESDPRIFSLGDTAAIPH
FT                   DPELPATAQVAFQQSQLLARNLLLARENQPLEEFKWKDLGEMLSLGVGDATLTGMGLTL
FT                   AGSSAYQLRRWTYLTRLPGCRLPLQVAAGWLSAPRP"
     gtgacctctc ccatcgtgat cgtgggtggc ggattcgccg gcctctacac cgccctggag        60
     ctggcgcggc gccccggaca tccgcccttg ctgctggtgg aaccgcgaga tcgcttcgtc       120
     tttctgccat tcctttacga gcgcctcagc ggcgaattgc cgctctggca aatggctccc       180
     cgctacgacg ccctcctcgc tggccatggc attggctggc aacgtgatcg ggtgacggcg       240
     gtggagccag gctcctgcca agtggtgctg gagagcggtc aacgcttggg ctatagccag       300
     ctggtgatcg ccaccggcgc caagcccgac agctttggca tcccaggggt tgaagagcat       360
     gccctgcgct tccacagcct ggaggatgtt gaagccctgc aggcgcaact gcccgccatt       420
     cgcaatcggg tggccatcgt tggcgctggc cccagcggcg ttgagctggc ttgcaagttg       480
     gccgacctgc tgcgcggcca agccaacgtc gagctgattg aacgcggtga gcgctgcttg       540
     ccccaggcca aggccttcaa ccgcagccaa gccgaactgg ccttgcagca acgcgatgtg       600
     cgcctgcgct gccaatgcgg ggtgaaagcc gttcaacccg gagagctaac cctccaagac       660
     gcccaaggcc aaagcagcag cttggcggtg gacgccgtgg tgtggacagc gggccagcgc       720
     accgctctgc ccggcggaac cttggccacc gacggtcgcg gccgcttgcg ctgcaacgcc       780
     agcctgcagc tggagagtga tccacgcatc ttcagccttg gcgataccgc ggccatcccc       840
     catgaccccg aacttccagc cacggcccaa gtggcgtttc agcagtccca gctcctagcc       900
     cgcaacctgc tgctggcccg tgagaaccaa cccctcgagg agttcaagtg gaaagatctc       960
     ggagaaatgc tgagcttggg tgtgggtgat gccaccctca caggcatggg gctgaccttg      1020
     gccggatcct ccgcctatca gctccgccgc tggacctacc tcactcgctt gccagggtgc      1080
     cgtttaccgc ttcaggtggc ggcgggctgg ctcagcgccc ctcgcccatg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page