(data stored in ACNUC29543 zone)

EMBL: CT978603.PE100

CT978603.PE100       Location/Qualifiers
FT   CDS_pept        97820..98803
FT                   /transl_table=11
FT                   /gene="SynRCC307_0100"
FT                   /locus_tag="SynRCC307_0100"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27003"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ44"
FT                   /protein_id="CAK27003.1"
FT                   /translation="MQELPVLLLTWRRPDATQKVLEVLRKVKPLILYVASDGPRHQSDW
FT                   DAIRCTRATIEKLVDWPCLVKKRYLSSNLGPGLSQSSSIDWFFGEQIKGLILEDDCIPH
FT                   PDLFPFCSELLNRYEMDMRVWTISGSNHQLGRRRGNASYFFSRYHHSWGWATWRSRWQE
FT                   YSQASQIWETLVSSTDAVNSLLDNLPSDLEAKYWMEKWTPLFVLSKPNWDYRWLLVCMA
FT                   NNGLTIIPNENLVENIGFGKDATHTTQLKQQGQLPERFFLRDHPICIYPNSQADQFTFD
FT                   FHYGGLQLKKDRRFHNQILRRLRLIVTNPMHYIRKINCYARGKQNH"
     atgcaggagt taccagttct tctactcaca tggcgtcgcc ccgatgccac acaaaaagtt        60
     ttggaggtac ttcgtaaagt taagccgtta attctttatg ttgcttctga tgggccacgc       120
     catcaatctg attgggatgc aattcgatgt actcgagcaa ctatagaaaa actggttgat       180
     tggccttgcc tagtcaaaaa aaggtatttg tcttcaaatc ttgggcctgg cttaagtcag       240
     tcgtcatcaa ttgattggtt ttttggtgag cagataaaag gcttaatact ggaggacgac       300
     tgcatccctc atcctgattt gtttcctttt tgcagtgaac tgctaaatcg ctatgaaatg       360
     gatatgaggg tatggacaat ttcaggaagt aatcatcagc ttggtcgccg ccgaggaaat       420
     gcaagttatt tttttagccg ctatcatcat tcgtggggtt gggcaacttg gaggtcaaga       480
     tggcaagagt actcacaagc ttctcaaata tgggaaactt tagtatcgtc aactgacgca       540
     gtaaattcct tgcttgataa tttgccttcg gatcttgaag caaagtattg gatggaaaaa       600
     tggaccccct tgtttgtctt gtctaaaccc aattgggatt atagatggct tttagtttgc       660
     atggctaata atggtctgac aattatcccc aatgagaact tggttgaaaa tattggtttt       720
     ggaaaggatg ctacccatac cacccaacta aagcagcaag ggcagcttcc ggagcggttt       780
     ttcttgcgtg atcatccaat ttgtatatat ccgaattctc aggctgatca atttactttt       840
     gattttcatt acggaggatt gcagttaaaa aaagatcgac gatttcataa tcagatttta       900
     aggcgtctgc gcttaatcgt gaccaatcct atgcattata ttcggaaaat taactgttat       960
     gctcgtggaa agcaaaatca ttga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page