(data stored in ACNUC29543 zone)

EMBL: CT978603.PE102

CT978603.PE102       Location/Qualifiers
FT   CDS_pept        100196..100954
FT                   /transl_table=11
FT                   /gene="SynRCC307_0102"
FT                   /locus_tag="SynRCC307_0102"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27005"
FT                   /db_xref="GOA:A5GQ46"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ46"
FT                   /protein_id="CAK27005.1"
FT                   /translation="MPYLINQKLFFVHIPKTAGSSIERAFGVHPSCNKTTSNSSASLRS
FT                   GPSLVNDVLRKTINLGLSFFASSSKHKEKNNFLIGYDQPSLVLQHLTLSEMFWLGYLSQ
FT                   AELSKSTFFSVVRHPKDRIISAWRSHQRHVEFPDINDFIESRLNSLSCTTHDERAHIRP
FT                   MSHYLDISNLPCPIRLHVLRLETIQTCWSSFGERVLRDPSINLRSWPSLPHYGSNRSHV
FT                   SPVSNQSLTVKSADLIKRYYSCDYENFAYQ"
     atgccttacc tgattaatca aaagcttttt tttgttcata ttccaaaaac agcgggctca        60
     tcaattgaga gagcctttgg tgttcacccg tcgtgtaata aaacaacctc caattcatct       120
     gcatctttga gaagtggtcc atcacttgtt aatgatgtct tgcgcaagac cataaatctt       180
     ggcttaagtt tttttgcctc ttcgtccaag cataaggaaa aaaataattt cttgattggt       240
     tatgaccagc ccagccttgt ccttcaacac ctcacgttga gtgaaatgtt ttggcttggg       300
     tatttatctc aagctgaatt atcaaagtca actttttttt ctgttgttcg gcatccgaag       360
     gaccgcataa tatctgcttg gaggtcacat caaaggcatg tcgaatttcc tgacatcaat       420
     gattttatag aatcccgatt gaattctttg agctgcacta ctcatgatga gcgcgctcac       480
     attaggccaa tgtctcacta ccttgatatt tctaatcttc catgcccaat ccgcttacat       540
     gtcctcaggc ttgaaaccat acaaacttgc tggtcttctt tcggcgaaag agtattaaga       600
     gacccgtcta ttaatttgcg ctcatggcct tcattgcctc attacggctc taatcgaagt       660
     catgtttcgc ctgtttcaaa tcagtcacta actgtcaaat cagctgattt aattaagagg       720
     tattattcgt gtgattatga gaattttgcc tatcaatag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page