(data stored in ACNUC29543 zone)

EMBL: CT978603.PE116

CT978603.PE116       Location/Qualifiers
FT   CDS_pept        complement(112454..113251)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0116"
FT                   /locus_tag="SynRCC307_0116"
FT                   /product="Uncharacterised conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27019"
FT                   /db_xref="GOA:A5GQ60"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ60"
FT                   /protein_id="CAK27019.1"
FT                   /translation="MGFFLSKLLPQLIYPLGLGLLLQLIAIGGRKQRWALPLSITGWLV
FT                   IAVPAMPVVSDALLRQLEDQAASLTPKSLPEADAVLVLGGGIRPAPAKGQGVEVNEAGD
FT                   RLLCGVRLWRQGKAPVLITSGARVSFTLNDPIAPEAVLSQQLAQELGVPASALLLNEKA
FT                   RTTAEEAQRINQLAAEQGWKQLILVTSAFHMPRALASFKRQSELQIIPVACDYQLDPQH
FT                   QNQAFSWGELLIDLIPSSDALDQTTQVLKEHLGLLVYQLRGQA"
     atggggtttt tcctcagcaa gctgctgccg caactgatct accctctggg gttggggctt        60
     ctgctgcaac tgatcgccat cggcggccgc aaacagcgtt gggccttgcc gctctcgatc       120
     acgggatggc tagtgatcgc cgtgccagcg atgccggtgg tgagcgatgc cctgctgagg       180
     caactggaag atcaggccgc ttcactcacc ccgaaatccc tccccgaagc tgatgcggtg       240
     ttggtgctgg gtgggggcat ccgtccggct ccagccaagg gccaaggtgt ggaggtcaat       300
     gaggctggcg atcggttgct ctgcggcgtg aggctctgga ggcagggcaa agcaccggtg       360
     ctgatcacca gtggcgccag ggtgagcttc acactgaacg acccgatcgc ccctgaagcg       420
     gtactgagtc agcagctggc ccaagagctg ggtgttccag cctcagctct gctgctcaat       480
     gagaaagcac gaaccaccgc agaagaagcg caacgcatca accagctcgc tgcagagcaa       540
     ggctggaagc agctgatttt ggtgaccagt gccttccaca tgccccgcgc cttagccagc       600
     ttcaagcgcc aaagcgagct tcagatcatt ccagtggcct gcgattacca gctggatcct       660
     caacaccaaa accaggcctt cagctggggt gagctattga tcgatctgat tcccagcagc       720
     gacgctctag atcaaacaac ccaggtgctc aaagaacacc tgggtctgct ggtctaccaa       780
     ttgcgaggtc aggcctaa                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page