(data stored in ACNUC29543 zone)

EMBL: CT978603.PE117

CT978603.PE117       Location/Qualifiers
FT   CDS_pept        complement(113251..113733)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0117"
FT                   /locus_tag="SynRCC307_0117"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27020"
FT                   /db_xref="InterPro:IPR030812"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ61"
FT                   /protein_id="CAK27020.1"
FT                   /translation="MESSWWQRLEQELEQQFDRFLSDHPNQKELLDQEHFNEQQRRKHH
FT                   RLLTIDQEAQDLRQRLLKLSKEISAWSERVGRARTAGAHDLAGRAESHLSHLMGQGRAQ
FT                   WQALAALGEEAKQLKQELAAAKQPPKTTTGKAADLEDAWQRFEAEQELDELRRRKS"
     atggaaagca gctggtggca aaggctcgag caagaactgg agcagcaatt tgatcgcttc        60
     ttaagcgacc accccaatca aaaggagctg ctggatcagg agcatttcaa cgagcagcaa       120
     cggcgcaaac accaccgcct actcaccatc gatcaagaag cccaagacct tcgccaacgc       180
     ctgctgaagc tgtccaaaga gatcagtgct tggagcgaga gggttgggcg cgcgcgcacc       240
     gcaggtgccc atgatctggc cggccgcgcc gaaagccatc tcagccattt gatggggcaa       300
     gggcgggccc agtggcaggc ccttgccgcc ttgggggagg aagcaaaaca attgaagcaa       360
     gagctcgccg ctgccaaaca accaccaaaa acaacaactg gaaaggctgc cgatctggag       420
     gacgcctggc agcgctttga agccgagcag gagctcgatg aattgcgtcg ccgcaagagc       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page