(data stored in ACNUC29543 zone)

EMBL: CT978603.PE119

CT978603.PE119       Location/Qualifiers
FT   CDS_pept        complement(113977..114975)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0119"
FT                   /locus_tag="SynRCC307_0119"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27022"
FT                   /db_xref="GOA:A5GQ63"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ63"
FT                   /protein_id="CAK27022.1"
FT                   /translation="MSPHATAQHFELIDLHPAPTDVSKAVIDGLNRSPKQLPAWLLYDR
FT                   QGSALFDAICEQPEYTLTRLEKDLLGTQAQAIAEALPTGCLVVEFGAGSAEKVSPLLDA
FT                   MHEPSYLAIDISAEHLQEAGTRLQERHPSIPMLGICADYSQPLDLPLPKAWQSKPMVGF
FT                   FPGSSLGNFEPDAAINFLQRIRQLLGEKAQLLIGIDQPREPSLLEAAYDDNAGVSAAFA
FT                   KNLLRRLQRDLAIELDPEPFTYQAAWQPEHQRIAMALVANTPQTWTIGASRIPFAAGEA
FT                   LMTEYSYKYAPIDFLDLAAQAGWQGSQRWCDADDHFSLHLLTQGDDARMNA"
     atgagccctc acgcgaccgc tcaacacttt gagctcattg acctgcatcc agcccccact        60
     gatgtgagca aagcggtcat cgacgggctc aaccgcagcc ccaagcaact gccggcctgg       120
     ctgctgtacg accgccaagg ctcagcccta tttgatgcca tttgcgagca accggaatac       180
     accctcaccc gacttgagaa agaccttcta ggcacccaag cgcaagcaat tgctgaggcg       240
     ttaccgactg gatgcctcgt cgtggaattt ggcgccggca gtgccgaaaa agtgtcgcca       300
     ttgctcgatg cgatgcacga gcccagttac ctggccatcg acatcagtgc tgagcacctg       360
     caggaagctg gcactcgctt gcaagagcgt cacccgagca ttcccatgct gggaatctgc       420
     gccgattaca gccaaccgtt ggacctgcca ttgcccaagg catggcaaag caaaccgatg       480
     gtgggatttt tccccggcag ctcgttaggc aattttgaac ccgatgcagc catcaacttc       540
     ctgcagagaa ttcgccaact gctgggagag aaagctcaac tgttgatcgg cattgatcaa       600
     cccagggagc catcactgct ggaagcggcc tacgacgaca acgcaggagt ctcagcagct       660
     ttcgccaaaa atctgctgcg caggctgcaa cgcgatttgg caatcgaact ggaccctgag       720
     ccattcacct accaagccgc ttggcagcca gaacaccagc gcatcgccat ggcactggtg       780
     gccaacaccc cgcaaacctg gaccatcggc gcttcacgca ttccgttcgc cgctggtgaa       840
     gcgctcatga ccgaatacag ctacaagtac gcgccgattg attttctgga tcttgctgct       900
     caagcgggat ggcaaggatc ccagcgctgg tgtgacgctg acgatcactt cagcctgcac       960
     ctgctcactc agggcgatga tgcccgcatg aacgcttaa                              999
//

If you have problems or comments...

PBIL Back to PBIL home page