(data stored in ACNUC29543 zone)

EMBL: CT978603.PE122

CT978603.PE122       Location/Qualifiers
FT   CDS_pept        117231..119204
FT                   /transl_table=11
FT                   /gene="SynRCC307_0122"
FT                   /locus_tag="SynRCC307_0122"
FT                   /product="Possible serine/threonine protein kinase"
FT                   /note="General function prediction only / Signal
FT                   transduction mechanisms / Transcription / DNA replication,
FT                   recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27025"
FT                   /db_xref="GOA:A5GQ66"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ66"
FT                   /protein_id="CAK27025.1"
FT                   /translation="MAVPTPAEAASGALLERRYRLDEVLSEAEGTRLWRGADTLVGELP
FT                   VAIRAWWGLTDEELAALQQRLERLKAVLHPQIPRLGEQLPAEGGCWQVREWISGRTYQD
FT                   LLQARQERQLVFGSGEVLLLLRQLLPALAALHGQNLVHGDLTPANLVRRDSDGLPVLID
FT                   FGLQAAVVGQPLTAATAGYAPPQARHEPYGLWMDLYSLGVVALVLLSGEEPAALMDPVS
FT                   LAWRWPEGIDLDAAFRQVLERLLATSPEQRFNSAAEVAEALTALPVPESTGPVSRSDRT
FT                   AVLLPQLKPEQQAEASPAPAPTRPTRDERRRAKEQAAEGRFWPVVIALLLAALVGSALG
FT                   WLLLGRNRQSNRPASALAPELSLPPAELDQRQQLLNRLRALQVDQAWFLKLVDSSLAAQ
FT                   FPERGGRAPTDSLEDAPLRKIWNDLAQEWLVRVEQLPVPLRQRLGSYTDADWKQREKSL
FT                   TKEGLSPLVLRQLVSSSAQNLLPGRNPETIPAEPVRQIWYAAALRSLEGLKVEQLKPVL
FT                   NVPSSLSTSVDGQGAKLIAINVPKNHRLVLGVNGTPLMQMSLFAANGKVLEPRGPLRVL
FT                   SVARVENSPVQLLIRNDGLAPGLISLSVRVDPPLPKPARETQRPRQQQPSAQPPNQPQP
FT                   QTPKQDSVLDEIKQPTVDPFGN"
     gtggccgtgc cgacccctgc tgaggccgcc agcggagcct tgcttgagcg ccgttatcgc        60
     ctcgatgagg ttctcagcga ggctgagggc acgcgcctct ggcgcggcgc cgacacgttg       120
     gtgggtgagt tgcccgtggc cattcgcgcc tggtgggggc tcacggatga agagttagcg       180
     gccttgcagc agcgcttgga gcggctcaag gccgtgctgc atccccaaat tccccgcttg       240
     ggggagcagt tgcctgccga gggtggttgc tggcaggtcc gcgaatggat tagtgggcgc       300
     acctaccaag acctgctgca ggcccgccaa gagcggcagc ttgtctttgg ctctggggag       360
     gtgctgctgc tgctgcggca gttgctgcct gccttagctg ctttgcatgg gcagaacctg       420
     gtgcatggcg atctgacccc cgccaatttg gttcgccgcg atagcgatgg actgccggtg       480
     ctgattgatt tcggcctgca agctgccgtc gttggtcaac cgctgactgc tgccacggcg       540
     ggctatgccc caccccaggc caggcacgag ccctatgggc tgtggatgga cctctacagc       600
     ctcggtgttg tggccctcgt gctgcttagt ggtgaagagc cagcagcctt aatggatccc       660
     gtgtcgctgg cctggcgctg gccggaaggg attgatctgg atgctgcgtt tcgccaggtg       720
     ctggagcggc tgctggcaac aagccctgag cagcgcttca actcagcggc tgaggtggct       780
     gaggcgttaa ccgctctgcc tgtccctgag agcaccgggc cggtgagccg ctcggatcgc       840
     acggctgtgt tgctgccgca gctcaagcca gagcagcaag cagaggcatc tcctgcccct       900
     gcgcccaccc gtccaacccg cgatgagcgc cggcgcgcca aagaacaagc cgcggaaggt       960
     cgtttttggc ctgtggtgat tgccctgctc ttggcagcgt tggtgggttc ggctttgggt      1020
     tggttgctgt tgggtcgcaa ccgccagagc aaccgcccgg cttcagcgct tgcaccggag      1080
     ctcagcttgc cgccagccga gttggatcaa cgccagcaat tgcttaatcg cctcagggcg      1140
     ttgcaggtcg atcaggcctg gtttctcaag ttggtggata gcagcctcgc ggctcagttc      1200
     ccggagcgag gcgggcgagc acccaccgac tccttggagg atgcgcccct gcgcaaaatc      1260
     tggaacgacc tagcccagga gtggctggtg cgcgttgagc agcttcctgt tcccctgcgc      1320
     caacgcctgg gcagttacac agatgcggat tggaagcaac gcgagaaatc cctcaccaaa      1380
     gagggtctga gtccattggt gctgcggcag ttggtcagca gcagcgctca gaacctgctg      1440
     cccggccgca atccagagac gattcctgct gagcctgtgc ggcagatctg gtatgccgca      1500
     gctctgcgca gcttggaagg cctcaaggtg gagcagctca agcctgtttt gaacgtcccg      1560
     agttcactaa gcacgtcagt ggatgggcaa ggggccaagt tgatcgccat caacgtgccc      1620
     aaaaaccatc gtttggtgct gggggtcaat ggcacgccgt tgatgcagat gagcttgttt      1680
     gccgccaatg gcaaggtgct ggagccccgt ggtccgctgc gggtgctcag cgtggcccgg      1740
     gtggagaact ccccggtgca gttgttgatt cgcaacgatg gcctcgctcc aggcttaatc      1800
     agcctttcgg tgcgggttga tccgcccttg cccaagcctg cgcgcgagac ccaacggcct      1860
     cgccaacagc agccttccgc tcagccgccc aaccagcctc agccccaaac tccgaagcag      1920
     gattcggtgc ttgatgagat caagcagccc acggttgatc cctttggcaa ttag            1974
//

If you have problems or comments...

PBIL Back to PBIL home page