(data stored in ACNUC29543 zone)

EMBL: CT978603.PE125

CT978603.PE125       Location/Qualifiers
FT   CDS_pept        120790..121548
FT                   /transl_table=11
FT                   /gene="SynRCC307_0125"
FT                   /locus_tag="SynRCC307_0125"
FT                   /product="Secreted tetratricopeptide repeat domains
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27028"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ69"
FT                   /protein_id="CAK27028.1"
FT                   /translation="MAWLMPTLLALLLGTTGLADQFHQALEASQQGRFAEALGLWDGVI
FT                   ELAPADSAAWSNRGNVRLALGDPEGAIADQTEAIRLEPEAIDPHLNRGTAEEALAQWDQ
FT                   AAADYNWILERQPDEAAALYNLGNVAGSLGDWPAARERFEAASLAQPGMAMARSSAALA
FT                   AFQIDELETSEKELRRLIRRYPLFADARAALTALLWQQGNAGEAESHWAAASGLDERYS
FT                   DPQWLLQVRRWPPEPVSALQRFLALDGGQP"
     atggcttggc tgatgccaac tctgttggcg ttgctgttgg gcaccaccgg gctggccgat        60
     cagtttcacc aggctttgga ggccagccaa cagggacgtt tcgctgaagc tctcggactt       120
     tgggatggcg tgattgagct tgctccagca gacagcgcag cctggagcaa ccgcggcaat       180
     gtgcgtttgg ccttgggtga cccagagggt gccattgccg atcagaccga ggcgatccgc       240
     ttggagcctg aggcgatcga cccccatctc aatcgcggca ctgccgaaga agccctagcc       300
     caatgggatc aagcagcagc tgattacaac tggattttgg agcgccagcc cgatgaggcc       360
     gccgcccttt acaacctggg caatgtggcc ggcagcctcg gggattggcc tgccgcacgg       420
     gagcgatttg aagcggcatc gctcgctcag ccagggatgg ccatggcgcg ctctagtgct       480
     gctttggcag cctttcaaat cgatgagctg gagacctcag agaaggaatt acgccggttg       540
     attcgccgtt accccctgtt tgcggatgcc cgtgcggccc taacggcgtt gctgtggcag       600
     caaggcaacg ctggtgaggc cgagagccat tgggccgcag cttcaggttt ggatgagcgc       660
     tacagcgatc cgcagtggtt gctgcaggtg cgccgctggc cgcctgagcc agtcagcgca       720
     ttgcagcggt ttttggctct cgatgggggc cagccatga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page