(data stored in ACNUC29543 zone)

EMBL: CT978603.PE136

CT978603.PE136       Location/Qualifiers
FT   CDS_pept        131547..131720
FT                   /transl_table=11
FT                   /gene="SynRCC307_0136"
FT                   /locus_tag="SynRCC307_0136"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27039"
FT                   /db_xref="GOA:A5GQ80"
FT                   /db_xref="InterPro:IPR021659"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ80"
FT                   /protein_id="CAK27039.1"
FT                   /translation="MVMILPGSTVRVSDGRSIYNGYQGFVQRISGDRAAVLFEGGNWDK
FT                   LVTLPLKTLTEV"
     gtggtgatga ttctccctgg cagcaccgtg cgggtgagtg atggccgctc gatctacaac        60
     ggctaccagg gctttgtgca gcgcatcagc ggtgacaggg ctgccgtgct gtttgaaggc       120
     ggtaactggg acaagcttgt gacgttgccg cttaagaccc tgaccgaggt ttga             174
//

If you have problems or comments...

PBIL Back to PBIL home page