(data stored in ACNUC29543 zone)

EMBL: CT978603.PE144

CT978603.PE144       Location/Qualifiers
FT   CDS_pept        138078..138932
FT                   /transl_table=11
FT                   /gene="SynRCC307_0144"
FT                   /locus_tag="SynRCC307_0144"
FT                   /product="Galactose mutarotase related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27047"
FT                   /db_xref="GOA:A5GQ88"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ88"
FT                   /protein_id="CAK27047.1"
FT                   /translation="MPLQELSAPYDHSVFTAENGDLIRVVPERGGLLTGWQVQGREIIY
FT                   LDLERFLTPGQSVRGGAPILFPICGNLPGDSLPLPDGRTATLKQHGFARNLPWSLSALS
FT                   DGRGVRLELSDSEQTRSEFPFEFLLQLDYRLAPGVLEVAMTLHNRSDQPLPFSFGLHPY
FT                   FSVSGLTSLSFEGMPEQGFDHKPMAAANTASVLTQLDQGIDLLVRPAGNVALVDAAAGQ
FT                   KLTMELSDPWNLAVFWTDPPRSMVCMEPWTGPRQSLISGDRKLELAPGEQRSLCTRYVV
FT                   STV"
     atgcctctgc aggaactgtc ggctccctat gaccattccg tgttcaccgc tgaaaacggt        60
     gatctgattc gggtggtgcc cgagcgaggc gggctgctca ccggctggca ggtgcagggc       120
     cgcgaaatca tctacttaga cctagagcgc tttctcaccc cgggccaatc ggttcgcggt       180
     ggtgcgccaa tcctcttccc catctgcggc aatctccccg gcgacagctt gccgttgcca       240
     gatggccgca cggccacgct gaagcaacac ggctttgctc gcaacttgcc ttggagcctg       300
     agtgccttga gtgatggccg gggcgtgcgg ctggagctca gcgatagcga gcaaacccgt       360
     tctgaatttc cctttgagtt tttgctgcag ctggattacc gcctggctcc cggagtgctt       420
     gaggtggcga tgacgctgca caaccgcagc gatcagccgt tgccgttcag ctttggactg       480
     catccctatt tcagtgtcag cggcctgacg agtttgagct ttgagggcat gccggagcag       540
     ggctttgatc acaaacccat ggccgcagcc aacaccgcca gcgtgctcac ccagttggat       600
     cagggcattg atttgttggt gcggcccgca ggcaacgtgg ccttggtgga tgccgcggcg       660
     ggccagaagc tcacgatgga gctcagcgat ccctggaatc tggcggtgtt ctggaccgat       720
     ccgccgcgat cgatggtgtg catggagccc tggacggggc cgcgccagag cttgatcagt       780
     ggcgaccgca agcttgagct ggcccctggg gaacagcgca gcctctgtac ccgctacgtg       840
     gtttcaactg tctaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page