(data stored in ACNUC29543 zone)

EMBL: CT978603.PE147

CT978603.PE147       Location/Qualifiers
FT   CDS_pept        141953..143395
FT                   /transl_table=11
FT                   /gene="SynRCC307_0147"
FT                   /locus_tag="SynRCC307_0147"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27050"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ91"
FT                   /protein_id="CAK27050.1"
FT                   /translation="MHAPAPGCGGAGSARSFRFGVAGPSADGSQGRWGPRGWLGCGERA
FT                   PTPPARAGRALGVEPDPACQAMASSPKIIVFDDDPTGSQTVRGCPLLLEFSTANLQAGL
FT                   ADPSPLLFLLTNSRALEPEQVRQELTALCRRLKPLLAQLTRPWLVVSRGDSTLRGHTPL
FT                   ELEVIRAELGPFAANVLVPAFPQGGRTTRDGVHLLHGEPLHHSAFARDQRFGYPSSDLP
FT                   QWLQHKTAGATPADCVARLKPADSFAELETGQWAVLDASTPNDLDVIGEQVLAELAKGR
FT                   KHLCQSAASLLNGLSEMPSVLLEPGEVPPIAAPGLVLVGSHVPLSDAQLSSLLQQPGCC
FT                   GVEFSLDGTPELGALTAQVQRLLSAGLTPVLFSSRGERTGYSPARQRELALQMAQVVMD
FT                   LEPPLGYVIAKGGTTSLTFLQQGLQLQQVRLLGQLLPGLSMVQPPLPHPRFGRLPVVTF
FT                   PGNLGDQTTLSRCWQLLEAARR"
     ttgcatgctc cagcacctgg ttgtggcggc gcaggctcag cacggagctt tcgatttggg        60
     gttgcgggcc ccagtgcaga tggttcccaa ggccgctggg gacccagggg ctggcttggc       120
     tgtggagagc gcgcaccaac tccaccagct cgtgccggtc gggcgttagg agtggagcca       180
     gatccggcat gccaggcaat ggcgagcagc cccaagatca tcgtctttga cgatgacccc       240
     actggctcgc agaccgtgcg gggctgtcct ctgctgcttg agttcagcac cgccaacttg       300
     caggcgggtt tggctgatcc ctccccgctg ctgtttttgt tgaccaacag ccgtgccttg       360
     gagcccgagc aagtgcgcca agagctcacg gccctgtgcc ggcgcctcaa gcctttgctc       420
     gcgcaattga cacggccttg gctggtggta agccgcggcg actccaccct gcgcgggcac       480
     acgccgctcg agctggaggt gatccgcgct gagttggggc cctttgccgc gaatgtgttg       540
     gtgccagcct tcccgcaagg ggggcgcact actagagatg gcgtgcacct tttgcatggt       600
     gagccgctgc atcactcggc gtttgcccgt gatcagcgct ttggctaccc cagcagtgat       660
     ttgccccaat ggctgcagca caaaacagca ggagcgaccc cggctgattg cgtcgcacgg       720
     ctgaagccag ccgattcctt tgcagagcta gagacgggac agtgggctgt gcttgatgcc       780
     agcaccccca atgatttgga tgtgatcggt gagcaggtgc tcgctgagct ggccaaaggg       840
     cggaagcacc tctgtcagag cgcagccagc ctgctgaacg gcctcagcga gatgccatcg       900
     gtgttgctag agccagggga agtgccgccg attgctgctc ctggcctggt gctggtgggc       960
     tcccatgtgc cgctcagcga tgcccagctg tcctcgttgc ttcagcagcc cggttgctgt      1020
     ggggtggaat tcagccttga tgggacacct gagctgggtg cgctcacagc tcaggtgcag      1080
     cggttgttga gtgctggcct cacgcctgtg ctgttcagca gccgcggcga acggactggc      1140
     tacagcccag cgaggcaaag ggagttggct ctgcagatgg cccaggtggt gatggatctc      1200
     gagccaccgc tgggctacgt gattgccaaa ggcggcacca ccagcctgac gttcctgcag      1260
     cagggcttgc agttgcagca ggtgcgcctc ctaggccagt tgctgcctgg tttgtccatg      1320
     gtgcagccgc ctcttcccca ccctcgtttt ggccggctgc ctgttgtcac tttccccggc      1380
     aatttggggg accagacaac cctcagccgt tgctggcagt tgctggaagc agcccggcgc      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page