(data stored in ACNUC29543 zone)

EMBL: CT978603.PE160

CT978603.PE160       Location/Qualifiers
FT   CDS_pept        156171..158213
FT                   /transl_table=11
FT                   /gene="SynRCC307_0160"
FT                   /locus_tag="SynRCC307_0160"
FT                   /product="Selenophosphate synthase fused with a
FT                   FAD/NAD(P)-binding domain"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27063"
FT                   /db_xref="GOA:A5GQA4"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR030805"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA4"
FT                   /protein_id="CAK27063.1"
FT                   /translation="MAAGQPHRLPVSHLLLAGGGHSHALLLRQWAMRPSTRPAVEAITL
FT                   VSAQPTSLYSGLIPACISGALAPKACVLDVWGLCRAAAVSFVQATVTGLDTANRQLSLK
FT                   GDRPPLAYDWLSLNLGAEVRAPKRLGCLPIKPLEPVLAALAALPLGAAVRVVGSGPAAV
FT                   EVSLALAARGFAVNLSGQPERAFWQGFRDSLNAAGVVLDPSLMRAHVELELHCTGSWGP
FT                   SWLAQSGLAVDGRGRVLTGADLRSVNDSSVFASGDCGVIDGRERPPSGVWAVRAAPVLA
FT                   ANLQRAVSRRRLRRWRPQPHALQLLGDGRGRAWALWAGRQLGPSRRIWRWKQHLDQRFM
FT                   AMLRPPQMASDQPMACSGCAAKLADAPLRGALQQLAGGQLPPAEDAAVAGDGWLQSVDG
FT                   FPALVADPYLNGRLTALHASSDLWACGASLRHGQALVTLPRCSELLQQELLVQSLAGVQ
FT                   SVMPLIGGHTLQALEASDPSKPLAKQLSLGLVVNGQLSPGQLSWGKGPLRPGHVLLLSR
FT                   PIGTGVLFAAAQAGSAEPQWLIAALEVMQQSQAPLVELLAAHGCSACTDVTGFGLLGHL
FT                   NEMLDASMGVDVQLQADQVPALAGSLELLEAGITSTLAPSNAVALARWPELLGTRARLL
FT                   IDPQTCGPLLAAVPEQQAGPCLAAMRLAGFSQAVRIGTVQSKGLL"
     atggcagcag gccaacccca ccggctaccg gtgagccatc tgctgctggc cggaggaggc        60
     catagccatg ccctgttgct gcggcaatgg gcgatgcggc cgtccacgcg gcctgcggtt       120
     gaggccatca cgttggtgag tgctcagccc accagcctgt attccggctt gatccctgca       180
     tgcatcagtg gtgctcttgc gcctaaggct tgtgtccttg acgtctgggg cctttgccgg       240
     gccgcagcgg tcagctttgt gcaggccacg gtcactggct tggacaccgc caaccggcag       300
     ctcagcctca aaggtgatcg cccgcctctg gcttacgact ggctcagcct caacctgggt       360
     gctgaagtca gggcacccaa gcggcttggc tgcctaccga tcaagccgct cgagccggtg       420
     ttggctgcac tcgcggcttt gccactgggt gctgccgtgc gggtggtggg cagtggtcct       480
     gcggcggtgg aagtcagttt ggctctcgct gctcgtggtt ttgccgtcaa cctgtcggga       540
     cagccagagc gtgctttctg gcagggcttc agggactccc tgaatgcggc aggagtggtt       600
     ttggatcctt cgctcatgcg tgctcatgtg gaacttgagc tccattgcac gggcagctgg       660
     ggcccgagtt ggcttgctca aagcggcctg gccgtagacg gccgcggccg cgtgctcacc       720
     ggagctgatt tgcgttcggt gaatgacagc tccgtgtttg cttcaggtga ctgcggtgtg       780
     attgatggcc gcgagcggcc ccccagtggt gtttgggcgg tgagagcagc ccccgttttg       840
     gcagccaact tgcagcgtgc tgtttcgcgt cgccgtttac ggcgctggcg cccgcaaccc       900
     catgccctgc aattgctggg cgatggtcgc ggccgtgctt gggccctatg ggcaggtagg       960
     cagctcggcc ccagccgccg gatttggcgc tggaaacaac acctcgatca gcgctttatg      1020
     gcgatgctgc gcccgcccca aatggccagc gatcagccca tggcctgcag tggttgcgcc      1080
     gccaagcttg ctgatgcgcc cttgcgcggg gccctgcagc agttggctgg tggccagctg      1140
     cctcctgcgg aggatgctgc ggtggctggt gatggttggc tgcagagcgt ggatgggttt      1200
     ccggctcttg tggcagaccc ttatctcaat ggacgcctaa cggctctgca tgccagctcg      1260
     gatctctggg cttgcggggc gtcgctgcgc catggccagg cgcttgtcac cttgccccga      1320
     tgttctgagc tcctgcagca ggagctgctc gttcagagcc tggcgggggt gcaatcggtg      1380
     atgccgctga ttggcgggca caccttgcag gcgctggagg ccagcgatcc cagcaagcct      1440
     ttggccaaac agctcagcct gggcttggtg gtcaacggtc agctctctcc cggccagctc      1500
     agctggggca agggaccgct caggcctggt catgtgttgc tgctcagccg gccgattgga      1560
     acaggcgtgc tcttcgcagc agcccaggct ggttcggcgg agccccaatg gctgatagct      1620
     gcattggagg tgatgcaaca gagccaggcg ccgctggttg agcttttggc tgcccatggc      1680
     tgcagcgctt gcaccgatgt gacagggttt ggcctcttgg gccatctcaa cgagatgctc      1740
     gatgcctcaa tgggggtgga tgtgcagctg caggctgatc aagtgccggc tttggctgga      1800
     tccttggagc tcctggaggc aggaatcacc agcaccttgg cccccagcaa tgctgttgcg      1860
     ctggcgaggt ggccagagct gttgggaacc cgcgcgcggt tgttgattga tccgcagacc      1920
     tgcgggcctt tgctagctgc tgtccctgag cagcaggctg gcccttgctt ggcagccatg      1980
     cgattagccg gtttttccca ggcagtacgg atcggaaccg tccaaagcaa ggggctgctt      2040
     tga                                                                    2043
//

If you have problems or comments...

PBIL Back to PBIL home page