(data stored in ACNUC29543 zone)

EMBL: CT978603.PE161

CT978603.PE161       Location/Qualifiers
FT   CDS_pept        158210..160225
FT                   /transl_table=11
FT                   /gene="SynRCC307_0161"
FT                   /locus_tag="SynRCC307_0161"
FT                   /product="Uncharacterized conserved membrane protein,
FT                   specific for cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27064"
FT                   /db_xref="GOA:A5GQA5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA5"
FT                   /protein_id="CAK27064.1"
FT                   /translation="MKRLFWPLLALLWLLSTVLDRRWLALDQRLPSWDQADYLNSALDH
FT                   GRALGLLPGGSWQGWSALLDHSPKIPPLASLVNGTVMAVSGDSPDQAAWTLSLWFGLLL
FT                   VGVALWGRQWQGPGLGLLAALFCVVAPGLAEWRVDYVLEIPLCAGCIWAQWLLGRWLRP
FT                   NGATWIAALLAALAIASALLIKQSALLVLLGPALWAVVVGLQERKRRWQLLASFGFVLA
FT                   LVAPWLGHNLITAIGGTNRATLESAAREGDPNATSLAGWLWYPKRLSGLIGQIPLIGGL
FT                   AGAVVAARRPSWPRGDGAWLWFVVLSGWLLTTLSPNKDPRYLAPLLPLLALLLARTWLV
FT                   LLAVMPKSWGQPLLGVGLLVSAWGTVQTRFQGILWAPVFPQPIEQIVDAAQGADPSTAR
FT                   TLIVVPSRPQLNQHSISFLGRRGGGGLVGRQLGSSSADIQPALKQAKQVLLATGDQGSV
FT                   RRSAEQFSQAIRSSGSFALQQQWPRPEGGTYELWARRPEASQPVPFEQRFPQLAAGLAL
FT                   GPAGLDPVFAAVGVEHQLDGHRLYQQRVEQQATAALAADPNDRQALWSLALLKVLQNRP
FT                   LEADHWFERLQKLEPKSPWPAAYRAVVLTAAGRLWQARAVADQAQGLNPSPVLEGLGDL
FT                   SGVLGGQLWRLPAASRSLPAATQAVEQQLKTPESAR"
     ttgaagcgtt tgttttggcc actactggct ctgctctggc tgctgagcac ggtgttggac        60
     aggcgctggc tggctttgga tcagcgcttg ccctcctggg atcaagccga ctatctcaac       120
     agcgctttgg accacggccg ggccttggga ttgctgcccg gtggcagctg gcaaggctgg       180
     tcagcgctgc tggaccattc ccccaagatc ccgccgctgg cctccttggt gaacggcacg       240
     gtgatggcgg tttcaggcga tagccctgat caggcggcct ggaccttgag cctttggttt       300
     ggtcttttgc tggtgggcgt tgcgctttgg ggccggcaat ggcaaggccc tgggcttggt       360
     ctgttggcgg ctttgttttg tgttgtggct ccggggctgg cggaatggcg tgtcgactac       420
     gtgctggaga ttcccctctg tgcggggtgc atttgggctc agtggttgtt ggggcgatgg       480
     ctgcggccaa acggggccac ctggatcgcc gctcttttgg ctgcgctcgc catcgccagt       540
     gcgctgttga ttaagcaaag cgccttgttg gtgctgcttg gtccggcgct ttgggcggtg       600
     gtggtggggc ttcaggagcg aaagcggcgc tggcagctgt tggcctcatt cggctttgtg       660
     ctggctttgg tggctccctg gctgggccac aacctgatca ccgccattgg tggcaccaac       720
     cgcgccacct tggagtcggc ggcccgcgag ggggatccca atgcaacgtc tctggcgggc       780
     tggctgtggt accccaagcg gttgtctggc ctgatcggtc agatcccgtt gatcggcggt       840
     ttggcaggag ccgtggtggc cgcccgcagg ccgagttggc cgcggggcga tggggcctgg       900
     ctttggttcg ttgtcttaag tggttggttg ctgaccaccc tcagccccaa caaagatccc       960
     cgttatctcg ctccattgct gcccttgctg gccttgttgt tagcccgcac ttggttggtt      1020
     ctgctggctg tgatgccaaa aagctggggc cagcccctgc tgggggttgg tttattggtt      1080
     tcagcttggg gaaccgttca gacccgcttt caaggcattc tctgggcgcc agtgttcccg      1140
     cagccgatcg agcagattgt tgatgctgcc cagggtgctg acccctcaac ggctcgcacg      1200
     ctgatcgtgg tgcccagtcg gccccagctc aatcaacaca gcatcagttt tttggggcgc      1260
     cgcggcggcg gcggcttggt tggccggcag ctcggttcca gctccgctga catccaaccg      1320
     gcgcttaagc aggcgaagca agtgcttctg gcaacaggtg atcagggctc agtgcgccgc      1380
     agcgctgagc agttctcgca ggcgattcgc agcagtggtt cttttgcact ccagcagcag      1440
     tggccgcgtc ctgagggggg cacctatgag ctttgggcgc gccggccgga ggcttcccag      1500
     ccggtgcctt ttgagcaacg cttccctcag ttagcggccg gtttggccct aggccctgcc      1560
     gggcttgatc cagtgtttgc agctgtgggt gttgagcacc agctcgatgg tcatcggctc      1620
     tatcagcagc gggtggagca acaggccact gctgctcttg cagctgatcc gaatgatcgt      1680
     caggcgctgt ggagcctggc tcttctgaag gttctgcaga acaggccact agaggctgat      1740
     cactggtttg agcgcttaca gaagctggag cccaagagcc cctggcctgc ggcttatcgg      1800
     gctgtggtgc tcactgcagc tggacgcctc tggcaggcca gggcagttgc cgatcaggcg      1860
     cagggcttaa atccatcgcc tgtgctggag ggtttgggag atctcagtgg agttctgggc      1920
     ggtcagctgt ggcgtctacc tgctgccagt cgttcgctgc cagcggctac gcaggcggtt      1980
     gagcagcagc tcaagacgcc ggaatcagcg cgctga                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page