(data stored in ACNUC29543 zone)

EMBL: CT978603.PE162

CT978603.PE162       Location/Qualifiers
FT   CDS_pept        complement(160200..160508)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0162"
FT                   /locus_tag="SynRCC307_0162"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27065"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQA6"
FT                   /protein_id="CAK27065.1"
FT                   /translation="MPTVLKFSSEDCGTCHRMSHYDGKVAEELGLGFVSVMLQDTETYR
FT                   KYRKVLMAQYPNKEGMGWPTYLIVTNPEGEFVIHGELKGGMPKGDFRDKLSALIPAS"
     gtgcccaccg ttctcaagtt cagctcggaa gactgtggca cctgtcaccg catgagccat        60
     tacgacggca aggtggccga agaactgggt cttggctttg tcagcgtgat gttgcaggac       120
     accgagacct accgcaaata ccgcaaggtg ttgatggccc agtaccccaa taaagaaggc       180
     atgggctggc cgacctacct gatcgtgact aatcccgagg gggagttcgt aatccatggc       240
     gagctcaaag gcggcatgcc caaaggcgat ttccgcgaca agctcagcgc gctgattccg       300
     gcgtcttga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page