(data stored in ACNUC29543 zone)

EMBL: CT978603.PE169

CT978603.PE169       Location/Qualifiers
FT   CDS_pept        complement(167397..168170)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0169"
FT                   /locus_tag="SynRCC307_0169"
FT                   /product="Uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis"
FT                   /note="Possible frameshift with RCC0170"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27072"
FT                   /db_xref="GOA:A5GQB3"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB3"
FT                   /protein_id="CAK27072.1"
FT                   /translation="MTSSLPIQSQAPAAGSTTSPQDEIDLREVIAALRRQWRWIGAGAG
FT                   VGLGAAALSLLTTKPVYQGEFQILLDDKNSSSSMARVLANNPALALLGTSGVNSETQTE
FT                   IAILNSPSVLLPVFKAVQARKPKEVAEKMRFSDWRDSALSIENAKGTSVLNVEFRDTDK
FT                   TIIAPITQLLSNEYQKYSNRGRNRELSNMSTYLQQEINKIKPISLASNREALEFGFANG
FT                   LGRARRACPWPGSRGGEFRGNNSNFPGGRGRRGQR"
     gtgacatcat cactccccat ccaaagtcaa gcacctgcag ctggttcaac cactagcccg        60
     caagacgaaa ttgatcttag agaggtcatt gcagccttgc ggcgccaatg gcgttggatt       120
     ggagctggag ctggggtggg cttaggagca gctgcgcttt ctcttttaac aacaaagcct       180
     gtctatcaag gggagttcca aatcctgctc gatgataaga acagctcatc ttccatggcc       240
     agggtgcttg ccaacaatcc agccttggct ttattgggga caagtggtgt caactcagaa       300
     acgcagacag aaatcgcaat tctcaatagc ccatccgttc tcctgccagt tttcaaagct       360
     gttcaagctc gtaaacccaa agaagtagct gaaaagatgc gattctccga ttggagagac       420
     agtgcactga gcatagagaa tgccaagggt acaagcgtat taaatgttga attccgtgat       480
     actgataaaa ctatcatcgc tcccataaca cagcttctat caaacgaata ccagaagtat       540
     tccaatcgag gccgcaatcg cgaattaagc aatatgagta cttacttaca gcaggaaatt       600
     aacaagatca agccaatctc attagcatcg aaccgtgagg ctttggaatt tggctttgcc       660
     aatggcctgg ggcgtgcgag aagggcttgc ccctggccag gttcccgggg gggggagttt       720
     cgggggaaca attcaaattt ccctgggggg agggggagga gggggcagcg ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page