(data stored in ACNUC29543 zone)

EMBL: CT978603.PE175

CT978603.PE175       Location/Qualifiers
FT   CDS_pept        complement(175010..176698)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0175"
FT                   /locus_tag="SynRCC307_0175"
FT                   /product="Asparagine synthase"
FT                   /EC_number="6.3.5.4"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27078"
FT                   /db_xref="GOA:A5GQB9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQB9"
FT                   /protein_id="CAK27078.1"
FT                   /translation="MCGLFGAWGWSQQLDTTAALEALKSRGPDDQGEFHDPCGLSLLHT
FT                   RLAIQDLSPLGHQPMQASDQSLVLVFNGEIYNQHKLRRELEAAGYNFRSHSDTEVLLNG
FT                   FHHWKQDLWHRLEGIFAVACWEPHDQRLTLARDRFGVKPLLWQRKPQRLAFASELSALI
FT                   ASGCCNKEALNPKAIESYLLWGSVAAPNTIVDGVQVFPAGHWASWELGESWQLRLFSPD
FT                   QPPAQRSDLNLSAATEQTRFALQQAVQRQSIGDRPVGLFLSGGLDSGLLAAELRRQQQG
FT                   AIHSVSVGFEGLPGAVDETDLAGQTADALELTHQRLGIGPQQLDHSFDGFLEAIDQPTI
FT                   DGFNSHLVTQAAHDQGMVVAFSGLGADELFGGYSHMQPGPLKGQLQARRLKLHGINQQS
FT                   RQALEQTRSSGLPSDLSLSECSELELRGYLHDTLLRDSDAVSMAQGLELRVPFLDSELV
FT                   DLALSIPADLHRAEGPKTLLRRLARNQLPEAVLNAPKRGFNLALAPWLLQHQRFHPTRI
FT                   WSLLQKQPLQLSRRSFWGSWILLRLSGRFKPYWRYVVLAEWLAQC"
     atgtgcggcc tgtttggagc ctgggggtgg tcccagcaac ttgatacaac cgcagccctt        60
     gaagcgctga aaagccgggg ccctgacgat cagggcgaat ttcatgaccc ctgcggcctc       120
     tccctgctgc acacccgctt agccatccag gacctttcgc ccctggggca tcagccgatg       180
     caagcgagcg atcaaagcct cgtgttggtg ttcaacggtg agatctacaa ccaacacaaa       240
     ctccgccgcg aattggaggc agcgggctac aacttccgct cacacagcga taccgaagtt       300
     ctgctcaatg gctttcacca ctggaagcaa gacctctggc acaggctgga ggggatcttt       360
     gccgtggcct gctgggagcc gcatgatcag cggttgaccc tggcgcgcga tcgctttggg       420
     gtgaaaccac tgctatggca acggaaaccg caacggcttg ccttcgcctc agaactcagc       480
     gccttgatcg ccagcggctg ttgcaacaaa gaggccctta acccaaaagc catcgagagc       540
     tacctgctct ggggttctgt ggctgcaccc aacaccatcg ttgatggggt gcaggtgttc       600
     cccgctgggc actgggccag ctgggaacta ggggaatcct ggcaactgcg gcttttcagc       660
     cctgaccaac caccagcaca acgcagcgat ctcaaccttt cagcagccac agaacaaacc       720
     cggttcgcgc tgcagcaagc cgtgcaacgc caaagcattg gtgatcgccc cgttggtcta       780
     ttcctcagtg gtggacttga ttccggcttg ctggctgctg aactgcgccg ccaacagcaa       840
     ggtgccatcc actcggtctc ggtgggattt gaaggtttac ccggagcagt tgatgaaact       900
     gatctcgccg gccaaacggc agacgctttg gagctgaccc atcaacgctt aggtatcgga       960
     ccccaacaac tagatcacag cttcgatggg tttttggagg ccatcgatca acccaccatt      1020
     gatggcttta acagccatct ggtgacgcaa gcagcgcacg atcagggcat ggtggtggcc      1080
     ttttcaggcc ttggagccga tgagcttttc ggcggctata gccacatgca gcccgggccg      1140
     ctgaagggtc agttgcaagc gcgccggctg aagctgcatg ggataaacca gcaaagccgg      1200
     caagccttgg agcaaacccg cagcagcgga ttacccagtg atctgagcct gtccgagtgc      1260
     agcgaactgg aactgcgcgg gtatctccac gacacactgc tgcgcgacag cgatgcggtg      1320
     tccatggccc agggcctgga actgcgggtg ccatttctcg attccgaact ggttgatcta      1380
     gcgctcagca ttccggctga cctccaccgg gccgagggcc caaaaacctt gctacggcga      1440
     ttggcgagaa accaactacc ggaggcggtg ctgaacgccc ccaaacgggg cttcaatttg      1500
     gccttggcac cgtggctact gcagcaccaa cgcttccatc ccacgcgaat ctggagtctt      1560
     ttgcagaagc aacccttgca gctttcacgg cgcagcttct ggggaagttg gatcctgttg      1620
     cggctcagtg gccgcttcaa gccctactgg cgttatgtgg tgctggccga atggctagcc      1680
     caatgctga                                                              1689
//

If you have problems or comments...

PBIL Back to PBIL home page