(data stored in ACNUC29543 zone)

EMBL: CT978603.PE181

CT978603.PE181       Location/Qualifiers
FT   CDS_pept        complement(183314..184021)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0181"
FT                   /locus_tag="SynRCC307_0181"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27084"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQC5"
FT                   /protein_id="CAK27084.1"
FT                   /translation="MDASQMEALDRPKRTVMPMRSDERLAQRIATEVLPRYPVTSILDI
FT                   GCGDGVVSKHLTGQTNYRGLDINEACIYEQEHDNPIVNYVQPEAIAKITQEEGPWDMIL
FT                   LLDVLEHTRDFTGLFEQAMLSSEKYVIVSLPNELFFLDRLRMLRGRELNAHSLDLVGLT
FT                   EGFKHQFIVNINKARSLLIKKAREHSFLLIEEVVRPLKPKRQLLGPIAQIITKLRQDQV
FT                   WSQGSIFIFHNHT"
     atggatgcca gccagatgga agcgttggat aggccaaaac gcacggtgat gcccatgcgc        60
     tcagatgagc gcttagctca gaggattgca accgaggttt tgccacggta tccagtcaca       120
     agcatccttg atatcggttg cggagatgga gttgtgagca aacacttaac cggacaaacc       180
     aattatcgag gacttgatat caatgaagcc tgcatttatg agcaagagca cgacaacccg       240
     attgtaaatt atgtgcaacc agaggcaatc gctaaaatca ctcaggaaga aggaccatgg       300
     gatatgattt tgttacttga tgtacttgaa catactagag attttacagg gttatttgag       360
     caagcaatgc tctcatccga gaaatatgta attgtgagct tgccaaacga attatttttc       420
     ttagaccggc tacgaatgct aagaggcagg gagctgaatg ctcatagttt agatctggtt       480
     ggactaacgg agggatttaa gcaccaattc atcgtcaata ttaataaagc acggtcattg       540
     ctaataaaaa aagcacgtga acatagtttt ctgctgattg aagaagtggt tcgcccactc       600
     aagcccaaaa ggcagctatt ggggccaata gctcaaatta taacaaagct gaggcaagat       660
     caagtatgga gccaaggtag catatttatc ttccataatc atacctaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page