(data stored in ACNUC29543 zone)

EMBL: CT978603.PE193

CT978603.PE193       Location/Qualifiers
FT   CDS_pept        194347..195456
FT                   /transl_table=11
FT                   /gene="SynRCC307_0193"
FT                   /locus_tag="SynRCC307_0193"
FT                   /product="Predicted pyridoxal phosphate-dependent enzyme
FT                   apparently involved in regulation of cell wall biogenesis"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27096"
FT                   /db_xref="GOA:A5GQD7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQD7"
FT                   /protein_id="CAK27096.1"
FT                   /translation="MSNLDPIYVTKPHLPPLEDFIPLLQQIWERRILTNNGPFHQELED
FT                   ALCKYLGVKHLSLFSNGTIALVTALKALGVSGEVITTPYSFVATAHSLLWNNITPVFVD
FT                   IDPVTFNLDPSKIEAAITDKTTAILPVHCYGFPCDVDAIQEIADRNGLKVIYDAAHAFG
FT                   VNCHCGSVLNHGDLSILSFHATKVFNTFEGGAIICHDKDTKQKIDKLKNFGFVGETEVE
FT                   ATGINGKMNELQAAIGLLQLQSIDVAIDQRSVISSTYREQIEKIEGLSCPPPSSALHYN
FT                   EAYFPILVKPEYRLSRDGLYEKLRQANIYARRYFYPLITDFSMYRHLFSSSPEKLPIAN
FT                   LVASQVICLPIYSTLSTEDLDRVLAILAY"
     atgagcaact tagatcctat ctacgtcact aagcctcatc tgccaccact agaggacttc        60
     attccactct tgcagcagat ctgggagaga cgtattttaa ctaacaatgg accctttcat       120
     caagagctcg aggatgcttt gtgcaagtac ctaggtgtca agcatttatc ccttttttct       180
     aatggcacaa tcgcccttgt tactgcttta aaagcgctag gtgtaagcgg agaggtcatc       240
     accaccccat actcttttgt cgctaccgct cattccttgc tctggaataa cataacacct       300
     gtttttgtag acattgatcc agttacattt aaccttgatc cttcaaagat tgaggcggca       360
     attactgaca aaacaactgc aattctcccg gtccattgtt atggatttcc gtgtgatgtt       420
     gatgcgattc aagagatagc agacagaaat ggtctaaagg ttatctatga tgctgcgcat       480
     gcttttggtg taaactgtca ctgtggaagt gttttaaatc atggggacct atctatactg       540
     agctttcatg cgacaaaggt ttttaatact tttgaaggag gagctattat atgccatgac       600
     aaagatacaa aacaaaaaat tgataaacta aaaaactttg ggttcgtggg cgaaaccgag       660
     gtagaggcta ccggcatcaa cggcaaaatg aatgaattgc aggcagcgat tgggcttttg       720
     caactacaat caatagatgt cgctatagat cagcgctctg ttatttcttc cacctatcgc       780
     gaacagattg agaagattga ggggctgagc tgtcctccgc cctcatctgc tctccattac       840
     aacgaagcat acttcccgat cttggtaaag ccagaatatc gtctttccag agatggcctc       900
     tacgagaagc taaggcaggc caacatctat gcccgccgtt atttctaccc tttaataact       960
     gatttttcga tgtatcggca tcttttttca tcatcgcctg aaaagttgcc gatagctaat      1020
     cttgtcgcga gccaggtgat ttgcctccct atttattcaa cccttagtac ggaagatttg      1080
     gatcgagtcc tggcaatact tgcttattaa                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page