(data stored in ACNUC29543 zone)

EMBL: CT978603.PE195

CT978603.PE195       Location/Qualifiers
FT   CDS_pept        197020..197319
FT                   /transl_table=11
FT                   /gene="SynRCC307_0195"
FT                   /locus_tag="SynRCC307_0195"
FT                   /product="Hypothetical protein"
FT                   /note="Possible pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27098"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQD9"
FT                   /protein_id="CAK27098.1"
FT                   /translation="MQQNSYLWIWCWAINSYNDINKNFKMLDSQLLDCLRNSGYDEIVD
FT                   IDFSKSFSDNGLDSLDVFSWISEVESETGISIEDDELQELKTPAQLLHLITSKQ"
     ttgcaacaga attcttattt gtggatttgg tgttgggcta tcaatagcta caatgatatt        60
     aacaaaaatt tcaaaatgtt agattcacaa ctgttagatt gtttgcgcaa ttccggttat       120
     gacgaaattg ttgatatcga tttttcaaaa agtttctctg ataatggttt agatagcctt       180
     gatgtattta gttggatctc agaagttgag tctgaaacag gaatatccat tgaggatgat       240
     gagcttcaag aattaaaaac tcctgctcaa ctgctacatc tcataacttc taaacaataa       300
//

If you have problems or comments...

PBIL Back to PBIL home page