(data stored in ACNUC29543 zone)

EMBL: CT978603.PE199

CT978603.PE199       Location/Qualifiers
FT   CDS_pept        201083..201916
FT                   /transl_table=11
FT                   /gene="SynRCC307_0199"
FT                   /locus_tag="SynRCC307_0199"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27102"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE3"
FT                   /protein_id="CAK27102.1"
FT                   /translation="MNIFSSLLLFAYLFLPNSPTQSVSSTPPVKFGIWGVDKISPSKEK
FT                   DLFCQLKKDNFDFIQSYSSFKTHSFKRLEGLLENIQECRINAILAIQPFRKNILVNPVF
FT                   NSKLQLLSLYSRNVLVQIADEPRSKNQVRFLPKICRHIEKFSLDAHLQEGVNPTILQCV
FT                   TQNGLHSHRKRPNINPSLKQIALNSHKLRRSRKDIVYTMRMFNSENQNNFVNVTYEDAK
FT                   NELCYVLQNIKPNKIAFYTYNKRYKGAGMMQDPGLYKIATQLVLKYKNNKLICQK"
     atgaatatat tttcatcact gttgcttttt gcttatttat ttcttccgaa ctcacctaca        60
     caatcggttt cctcaactcc tccagtaaag tttgggatat ggggtgtaga taagattagc       120
     ccctctaaag aaaaggattt attttgtcaa ttgaaaaaag ataattttga ctttattcag       180
     tcatactctt ctttcaagac tcatagcttt aaacgtttag agggtttatt ggaaaatatt       240
     caagaatgtc gtattaatgc catcttagcc atccaacctt ttaggaagaa tattttagtg       300
     aaccctgttt ttaattcaaa actgcaatta ctatcgctct attctcgcaa tgtccttgtt       360
     caaattgcag atgaacctcg cagcaaaaat caagtgagat tccttccgaa aatctgtcgg       420
     catatagaga aattttccct tgatgctcat ttgcaagaag gtgtcaatcc gacaattcta       480
     cagtgtgtta ctcaaaatgg cttgcattca caccgcaagc ggcccaatat taaccctagt       540
     ctcaaacaaa tagctctaaa ttcacacaaa ctgagaagga gccgaaaaga tattgtttac       600
     acgatgcgaa tgtttaattc tgagaatcaa aacaacttcg ttaatgttac ttatgaggac       660
     gcaaagaacg agctttgcta tgttcttcaa aacatcaagc ctaataagat tgctttttat       720
     acctataata agcgctataa aggtgcaggc atgatgcaag atccaggcct ttataaaata       780
     gccactcagc ttgtgctaaa atataaaaat aacaaactta tttgccagaa atga             834
//

If you have problems or comments...

PBIL Back to PBIL home page