(data stored in ACNUC29543 zone)

EMBL: CT978603.PE2

CT978603.PE2         Location/Qualifiers
FT   CDS_pept        1314..2042
FT                   /transl_table=11
FT                   /gene="SynRCC307_0002"
FT                   /locus_tag="SynRCC307_0002"
FT                   /product="RNA metabolism-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26905"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPU6"
FT                   /protein_id="CAK26905.1"
FT                   /translation="MPLPRQILISELLRSRLRDELGQDLGVGHQVWMHPPCHRLLGWSS
FT                   RPSAFGPRRSVWRLDQLVDWLEGQVEVEGEPADTEQPTLDLLPTLMEATLLGQQQQPLG
FT                   RLVDAVVDVQSGRINHYLVARSDPRLPGSSRWRLEPDRLIDQQPGQVQAALQELDDLPL
FT                   DRASIRQQMLRRSRQIRDQVPDSFDDFEGRLRSFGQRLWDGGEDLIERWRDEEPPVDER
FT                   RSRPRSRDWDDPDDGEDPWI"
     atgccgcttc cccgccagat cttgatcagt gagctgttgc gctcacgctt gcgggatgag        60
     ttggggcaag acctgggtgt tggtcatcag gtctggatgc atcccccgtg ccatcgcttg       120
     ctgggctgga gttcgcgtcc gtcggccttt ggcccgcggc gctcggtgtg gcgtctcgat       180
     caactggtgg attggttgga ggggcaagtg gaggtggagg gagagcccgc cgacaccgaa       240
     cagcccacct tggatctgct gcccaccttg atggaggcca ccctgctggg tcagcagcag       300
     cagcccctag gccgtctggt ggatgcggtg gttgatgtgc agagcggacg catcaatcac       360
     tacctggtgg cccgtagtga tccccgtttg cctggcagta gccgctggcg gttggaaccc       420
     gatcgcttga tcgatcaaca gccggggcaa gtgcaggctg ccttgcagga gctcgatgat       480
     ctccccttgg atcgcgcgag catccgtcag cagatgctgc gccgtagccg tcaaattcgc       540
     gatcaagttc ccgactcttt tgatgacttc gaggggcgct tgcgttcctt tggtcagcgc       600
     ctctgggatg gcggtgagga tctaatcgag cgttggcgcg atgaggaacc gcccgttgat       660
     gagcgccgca gccgtccgcg tagccgcgat tgggatgatc ccgacgatgg cgaggatcct       720
     tggatctga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page