(data stored in ACNUC29543 zone)

EMBL: CT978603.PE200

CT978603.PE200       Location/Qualifiers
FT   CDS_pept        202620..203888
FT                   /transl_table=11
FT                   /gene="SynRCC307_0200"
FT                   /locus_tag="SynRCC307_0200"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27103"
FT                   /db_xref="GOA:A5GQE4"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE4"
FT                   /protein_id="CAK27103.1"
FT                   /translation="MLVLFTLCLFQATRWFGIERSIFYILTCILLALLIGLIGKYSITK
FT                   QSTLAFLLIATFSLPAIINFALIPTVSLSQALLPFVGFLKVFLLLLLLSSLPLTTSINF
FT                   IHRFMLFATSYGFLQWIISSLGFAQRASLIDSHYEIVGFFPIWRVNSLWGESQHFSQVL
FT                   VFYLLFCFVESSLLNPTENISRKFGIYLSLFMLATSGSTTGYFLSLFVITSHLILSLTK
FT                   PFLSNLPLSYSSLHSPLTSLKKIFHFILRKQYFFLLLTVFFAFTVFVSTSDALLRQFAK
FT                   QSSRASLVASFILDTNNLSTGSSGWDSGTRAQSLIRAKDYLSNPSKLPQYSPELATKSK
FT                   DGFLLNFVRFGFIGSFMVTISLLIVCYIYNFDPLMSLGFLALVLIFWFRGETINATSFQ
FT                   FGLVLSLFMLSFKYGNSRVPARN"
     atgttagttc tatttacttt gtgcctgttt caagctacta ggtggtttgg cattgagaga        60
     agtatattct acattttaac atgcattctt ttagcacttt tgatcggctt aataggtaaa       120
     tattccatca ccaaacagtc taccctggca ttcttattaa ttgcaacctt ttctttgcct       180
     gcaattatta attttgctct tataccaact gtaagtcttt cacaggccct tttacccttt       240
     gtcggctttc ttaaagtctt tctacttctt cttcttcttt ctagcttgcc tttaactaca       300
     tcaataaatt ttatccacag attcatgcta ttcgcaacct catatggatt tttgcagtgg       360
     attatttcat cacttggttt cgcacaaagg gcgagtttga tcgattcgca ttatgaaata       420
     gttgggtttt tccctatctg gcgagtgaat tcactgtggg gtgaaagtca gcatttttcc       480
     caagtactcg tcttttatct tttattttgc ttcgtcgaga gttctctttt aaaccccacc       540
     gaaaatatat caagaaaatt tggcatttat ctctcccttt ttatgttggc aacaagtggc       600
     agtacaacag gttatttctt aagtcttttt gtcattactt ctcatcttat cttgtctttg       660
     actaaacctt ttttgagcaa cttaccctta agttactctt cactccactc cccactgaca       720
     tcattaaaaa agattttcca tttcatcctt cgaaagcaat atttcttttt gttattgaca       780
     gttttttttg cttttactgt atttgtgtcc acttctgatg ctcttcttcg tcagtttgca       840
     aagcaatcta gtagagcgag tctagttgct tcttttatat tggatacaaa taatctatca       900
     actggttcta gtggctggga ctctggtact cgtgctcaat ctttaattcg cgccaaagat       960
     tatttatcga atccttctaa gcttccacaa tattctcctg agcttgccac aaaatccaaa      1020
     gatgggtttt tacttaactt tgtcaggttt ggatttattg gttctttcat ggttactatc      1080
     tcacttttaa tagtatgtta tatatataat tttgaccctt taatgtcgtt gggattcctc      1140
     gctttagtct taatattttg gtttcgcggt gaaacaatta atgctacatc ttttcaattt      1200
     ggcttggttc tctctctttt catgctctca ttcaaatatg gcaattctcg tgttccagct      1260
     agaaactaa                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page