(data stored in ACNUC29543 zone)

EMBL: CT978603.PE204

CT978603.PE204       Location/Qualifiers
FT   CDS_pept        207383..208579
FT                   /transl_table=11
FT                   /gene="SynRCC307_0204"
FT                   /locus_tag="SynRCC307_0204"
FT                   /product="Sulfolipid biosynthesis protein
FT                   (UDP-sulfoquinovose synthase)"
FT                   /EC_number="3.13.1.1"
FT                   /note="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27107"
FT                   /db_xref="GOA:A5GQE8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQE8"
FT                   /protein_id="CAK27107.1"
FT                   /translation="MKVLVLGGDGFCGWPCAVNLADQGHDVLIVDNLSRRKIDIDLEVE
FT                   SLTPITNIGERLKAWSEIGGKPMRFVHLDIAHEYQRLLDLLLEEKPDSVVHFAEQRAAP
FT                   YSMKSSATKRYTVDNNVNGTHNLLAAIVESGLDIHVVHLGTMGVYGYGSHRGATIPEGY
FT                   LKVEVPQPDGSRFEEEILHPASPGSVYHMTKTLDQLLFLYYNKNDQVRITDLHQGIVWG
FT                   TNTEATDRDPRLTNRFDYDGDYGTVLNRFLMQAAIGYPLTVHGTGGQTRAFIHIRDSVR
FT                   CVQLALDNPPVKGERVKIFNQMTESHQVGELAKKVAALTGAQVNNLPNPRNEAVENDLI
FT                   VDNRCFIELGLNPTTLDDGLLKEVVEIATRYADRCDRNRILCTSAWTKTQEQAIRAGS"
     atgaaggtcc tggtccttgg tggtgacggc ttttgcggct ggccatgcgc cgtgaatttg        60
     gccgatcagg gccacgacgt tctgatcgtt gacaacctca gccgccgcaa gatcgacatc       120
     gatctggagg tggaatccct aaccccaatc accaacattg gtgagcgcct caaggcctgg       180
     agtgagatcg gcggcaaacc gatgcgcttt gtccacctgg acatcgccca tgagtaccag       240
     cggctcctgg atctgcttct cgaggagaag cccgactcgg tggtgcattt cgccgagcaa       300
     cgcgctgccc cctattcgat gaagagcagc gccaccaagc gctacaccgt cgataacaac       360
     gtcaacggca cccacaacct gctggccgcc atcgttgaaa gtggcctcga tattcacgtg       420
     gtgcacctcg gcaccatggg ggtctacggc tatggctccc accgcggcgc caccatcccc       480
     gagggctacc tgaaggtgga agtgccacag cccgatggca gccgttttga ggaggagatc       540
     ctccaccccg ccagcccggg cagcgtctat cacatgacca agacgctgga tcagctgctc       600
     ttcctctact acaacaaaaa cgatcaggtc cgcatcaccg atctgcacca gggcatcgtt       660
     tggggcacca acactgaagc caccgaccgc gatccacgct tgaccaatcg ctttgattac       720
     gacggcgact acggcacggt cttgaaccgc ttcttgatgc aggcggccat tggctacccc       780
     ctgaccgtgc atggcaccgg cggccagacc cgcgccttca tccacatccg cgactcggtg       840
     cgctgcgtgc agctggcctt ggacaaccct ccggtcaaag gcgagcgggt caagatcttc       900
     aaccagatga ccgaaagcca tcaggtggga gaactggcca agaaggtggc cgcacttacc       960
     ggcgcgcagg tcaacaacct gcccaatccc cgcaatgaag cggtggaaaa cgatctgatc      1020
     gtggacaacc gctgcttcat tgagctgggc ctcaatccca caaccctcga tgatgggttg      1080
     ctgaaggaag tggtggagat cgccacccgt tatgccgacc gctgcgaccg caaccggatc      1140
     ctctgcacgt ctgcctggac caaaacccaa gaacaggcca ttcgtgcagg ctcatga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page