(data stored in ACNUC29543 zone)

EMBL: CT978603.PE216

CT978603.PE216       Location/Qualifiers
FT   CDS_pept        complement(214426..215877)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0216"
FT                   /locus_tag="SynRCC307_0216"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27119"
FT                   /db_xref="GOA:A5GQG0"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQG0"
FT                   /protein_id="CAK27119.1"
FT                   /translation="MSRLARGSKPATDRLLTVQAMTRLPRAGEQSRRGELVDRSRRAVQ
FT                   WLQPGLVVKRWVLTSALGFVLALLGAAIWADLKPIYWILTTVDDLLRVLAGAGREFTGP
FT                   LVLLVGIGLVLLGQSRSFGSIQRALAPQKDTALVDALLAQRRLNRGPNIVAIGGGTGLS
FT                   TLLSGLKRYSGNLTAIVTVADDGGSSGVLRRELGVQPPGDIRNCLAALAREEPLLTRLF
FT                   QYRFTAGGGLEGHSFGNLFLSALTAITGNLETAITASSKVLAVQGQVVPATSADVRLWA
FT                   ELENGERLEGESCIGQANSPIVRLGCTPSRPAALPRALEAIAHADMIVLGPGSLYTSLL
FT                   PNLLVPELVEAISRSQAPRLYICNLMTQPGETDGLDVSGHLRAIESQLASIGVQQRLFD
FT                   AVLAQDTLPSGPELDYYRARGAEPVDCDLDGLKQEGYRVMLASMQGPQQRSEGRAFKGT
FT                   LRHDSRSLALAVMRFYRAKQKRQIN"
     ttgtcacggc ttgccagagg ctccaagcca gccacagaca ggctccttac agtgcaggcc        60
     atgacccgtt tgccaagagc tggagagcag tcccgccgcg gcgagctggt ggatcgctct       120
     cgccgggcgg tgcagtggct gcagcccgga ttggtggtca aacgctgggt tctcacctca       180
     gctctgggat ttgtgttggc cctgctgggg gctgccattt gggctgatct caaacccatc       240
     tactggatcc tcacaacagt cgacgacctg ctgcgggtct tggccggcgc cggcagggaa       300
     ttcacaggcc ctctggtgct gctagtggga attggtttgg tgcttcttgg ccaaagccgc       360
     agctttggct cgatccaacg tgcgctagct cctcaaaaag acacagccct cgttgatgcc       420
     ctcttggccc aacgccgcct gaatcgcggc cccaacatcg tggccatcgg tggtggcacc       480
     ggactctcca ccctgctcag cgggcttaag cgctacagcg gcaatctcac cgccatcgtc       540
     acggtggccg atgacggcgg cagcagcggc gtgctgcgcc gcgagcttgg agtgcaaccc       600
     ccgggcgata tccgcaactg cctggcggca ctcgctagag aagaacctct gctgacgcgg       660
     ttgttccaat atcgcttcac cgctggaggc ggcttggaag gccacagctt cgggaacctt       720
     tttctctcgg ccctaacagc gatcaccggc aacctcgaaa cagcgatcac cgccagcagc       780
     aaagtcttgg cggtgcaagg gcaagtggta cctgccacca gcgctgatgt tcgcctctgg       840
     gctgaactcg aaaacggcga gaggctggag ggggagtcct gcattggcca agccaacagc       900
     ccgatcgtgc gtctgggctg cacaccctcc cgcccggctg cgttgcctcg ggcgctggaa       960
     gccatcgccc acgccgacat gatcgtgctg ggccccggaa gcctttacac ctccttgctt      1020
     cccaacctct tggttccaga gttggtggaa gcgatttccc gctcacaggc tccacggctt      1080
     tacatctgca acctgatgac ccagccaggg gaaaccgatg gcctggatgt gagcggacat      1140
     ctacgtgcga tcgaatccca gctggccagc atcggggtgc aacaacgcct ctttgatgcg      1200
     gtactggccc aagacaccct tccttcaggg ccggaactgg actactaccg ggcgcgcggc      1260
     gctgaacccg tggattgcga tctcgatggc ctcaagcaag agggctatcg ggtgatgctg      1320
     gcttccatgc aggggcctca acaacgcagt gaaggacgtg ccttcaaagg caccctgcgc      1380
     cacgattctc gcagccttgc tttggcggtg atgcgtttct accgggccaa acaaaaacgc      1440
     cagatcaact ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page