(data stored in ACNUC29543 zone)

EMBL: CT978603.PE229

CT978603.PE229       Location/Qualifiers
FT   CDS_pept        complement(229160..230053)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0229"
FT                   /locus_tag="SynRCC307_0229"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27132"
FT                   /db_xref="GOA:A5GQH3"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH3"
FT                   /protein_id="CAK27132.1"
FT                   /translation="MIQAGDSGTRLAIRLLQDAAERGEIEPWDVDVIAVVDGFLDQLRQ
FT                   KLELPRLIASAGGSYEQDLAESSEAFLAASVLVSLKAEHLEASTFQAAEVDDDDVDLLL
FT                   EQLAEDDGDWPALRALPSRPEKLLQRRTVAPPPLQRPVTLGELIRQLEDIGERLEQEGG
FT                   RQPKQRRKRYSDREAIAQVASLAHREKLPETTAALSQFLSRWDVGWEWQQFDGLVAAWA
FT                   AVAPEDLDQDRVGVFWALLFLCSQGRVDLQQDERDLFGPLQLRVRPSEEDQQRQGVLHF
FT                   VPPGSAALPASELKAA"
     gtgatccagg ccggggacag tgggacacgc ttagccatcc ggctactcca agacgcggcc        60
     gagcggggcg agatcgagcc ctgggatgtg gatgtgatcg cagttgttga cggttttctt       120
     gatcaactgc gccaaaaact ggaactgccg cgtctgatcg cctcagctgg cggcagctac       180
     gaacaagacc ttgccgaaag cagcgaagcc tttttggccg cttcagtctt ggtgtcgctg       240
     aaagcagagc acttggaagc cagcaccttc caggcggcgg aagtcgatga cgatgacgtc       300
     gatctgttgc tcgagcagct tgctgaagac gatggcgact ggccggcgtt gcgcgccctg       360
     ccctccaggc cggaaaaact gctgcagcgc cgcaccgtgg ccccgccgcc actgcagcgc       420
     cccgtcacct tgggggaatt gatccgccaa ctggaagaca ttggcgaaag gctcgagcaa       480
     gagggcggcc gccaacccaa gcagcggcgc aagcgctata gcgaccgcga ggccattgcc       540
     caggtggcct cattggctca ccgcgaaaaa ctgccggaaa ccacggccgc cctcagccaa       600
     ttcctcagcc gctgggatgt gggctgggag tggcagcagt tcgatggtct ggtggccgcc       660
     tgggccgccg tggctccaga ggatctcgat caagacaggg ttggggtgtt ctgggcgctg       720
     ctgtttctct gcagtcaggg acgggtggat ctgcagcagg acgagcgaga tctgtttggc       780
     cccctgcaac tacgggtgcg gcccagcgaa gaagatcaac agcggcaagg cgtgctgcac       840
     tttgttccac ctgggtcagc tgccctgccg gctagcgaat tgaaagcggc ctaa             894
//

If you have problems or comments...

PBIL Back to PBIL home page