(data stored in ACNUC29543 zone)

EMBL: CT978603.PE230

CT978603.PE230       Location/Qualifiers
FT   CDS_pept        complement(230092..230445)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0230"
FT                   /locus_tag="SynRCC307_0230"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27133"
FT                   /db_xref="GOA:A5GQH4"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQH4"
FT                   /protein_id="CAK27133.1"
FT                   /translation="MPQINFVLIFVFGLAMVMFTLENTAATTVRFLPGMSTTMPLAVLL
FT                   LIVGGVGATAAWVFAVWTGVTRNITAGEQNQAQQVQIQELQQDVERYRAAMDAQLSMLP
FT                   ASGQSSSGVAEAS"
     atgccccaga tcaattttgt gctgatcttc gtgttcggcc tggcaatggt gatgttcacg        60
     ctcgagaaca ccgcagccac caccgtgcgc ttcctgcctg ggatgagcac cacgatgcct       120
     ctggcggtgc tgctattgat cgttggcgga gtaggggcca cagcagcctg ggtgtttgcg       180
     gtttggactg gggtcacccg caacatcacg gcaggcgagc agaaccaggc gcaacaggtt       240
     caaatccaag aacttcagca ggacgtcgag cgctaccggg ctgccatgga tgcccagctc       300
     agcatgctgc ccgcgtctgg gcagagcagc tcaggggtgg ctgaagcgag ttaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page