(data stored in ACNUC29543 zone)

EMBL: CT978603.PE236

CT978603.PE236       Location/Qualifiers
FT   CDS_pept        complement(236901..237518)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0236"
FT                   /locus_tag="SynRCC307_0236"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27139"
FT                   /db_xref="GOA:A5GQI0"
FT                   /db_xref="InterPro:IPR021511"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI0"
FT                   /protein_id="CAK27139.1"
FT                   /translation="MAPRRPPSRYDDDRYDERDRYERRPPQRGGSGGNKGGGGAGLTFN
FT                   TATIAVLAGILIIGIGIGTSLTSNTSGSQGNIASSEQLDLAVPDPEFCKQWGASAFVMD
FT                   VEMYTTMNPSTSFVTQPKLQPGCVIRRENWAVLQKAGAVTTDQMRDCKQRMNTFAYIGS
FT                   IRDKPIVRCVYQTDAGENKFQNPGIAGAADDTVGITPEADQF"
     atggcccccc gccgtccccc gtcccgctac gacgacgatc gctacgacga acgcgatcgc        60
     tatgaacgcc ggccgcccca acgcggtggc agtggcggta ataaaggtgg tggtggagct       120
     gggctcacct tcaacaccgc cacgatcgcc gttttggccg gcatcttgat cattggcatc       180
     ggtatcggaa catccctaac cagcaacaca tcgggctccc agggcaacat cgccagcagt       240
     gagcagctcg atctggccgt gcctgacccc gagttctgta agcagtgggg ggctagcgcg       300
     tttgtgatgg acgtggagat gtacacgacc atgaacccct ccaccagctt tgtaacccag       360
     cccaagttgc agccgggctg cgtgatccgc cgggaaaact gggccgtgct gcaaaaagcc       420
     ggtgcggtta ccaccgatca gatgcgcgat tgcaagcaac ggatgaacac ctttgcctac       480
     atcggttcga ttcgcgataa gccaatcgtg cgctgcgtct atcaaaccga cgcgggtgag       540
     aacaaattcc agaaccccgg catcgctggc gctgctgatg acaccgtggg catcacccca       600
     gaagcggatc agttctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page