(data stored in ACNUC29543 zone)

EMBL: CT978603.PE241

CT978603.PE241       Location/Qualifiers
FT   CDS_pept        complement(241173..241607)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0241"
FT                   /locus_tag="SynRCC307_0241"
FT                   /product="RNA-binding protein, RRM domain"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27144"
FT                   /db_xref="GOA:A5GQI5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI5"
FT                   /protein_id="CAK27144.1"
FT                   /translation="MSTRLYVGNLPQNFDQKELEGMFAAVGAGVRFKAVLDRDTGVCRG
FT                   FGFVNLDDPKLTDAVIEQFNNREYGGNQLRVEVSERRESRGNDRGGDRRRGPGGGPAVA
FT                   RKSVDKVVHSEPADKEAPDPRWAGELSKLKDLLANQKASV"
     atgagcactc gtctctacgt cggcaatctg ccccagaact tcgatcaaaa agagttggag        60
     gggatgtttg cggcggtcgg agcaggtgtg cgtttcaaag cagttctcga tcgcgacacc       120
     ggcgtctgcc gcggctttgg cttcgtcaac ctcgatgacc ccaagctcac cgatgcggtg       180
     atcgagcagt tcaacaaccg cgagtacggc ggcaaccagc tgcgcgttga agtgtccgag       240
     cgccgtgaat cccgcggcaa cgaccgcggc ggtgatcgtc gccgcggtcc cggtggcggt       300
     cctgccgtgg cacgcaagag cgtcgacaag gtggtgcaca gcgagcccgc cgacaaggaa       360
     gctcccgacc cacgctgggc cggcgaactc tccaaactga aggacctctt ggccaaccag       420
     aaggcctcgg tctaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page