(data stored in ACNUC29543 zone)

EMBL: CT978603.PE243

CT978603.PE243       Location/Qualifiers
FT   CDS_pept        242898..243146
FT                   /transl_table=11
FT                   /gene="SynRCC307_0243"
FT                   /locus_tag="SynRCC307_0243"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27146"
FT                   /db_xref="InterPro:IPR019656"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQI7"
FT                   /protein_id="CAK27146.1"
FT                   /translation="MCICVDCQWVDRCKAYHRVETQHGEPHLNAEPNFEPEQPRIHVSL
FT                   RPIENSWGIEWDVRSCSSFALDRGHWQRLRPGAPVPT"
     atgtgcatct gtgttgactg ccagtgggtg gatcggtgca aggcctacca ccgcgtggaa        60
     acccagcacg gtgaacccca cctcaacgct gagcccaatt ttgagcctga gcagccccgc       120
     attcacgtga gtttgcgccc catcgagaac agctggggca tcgagtggga tgtgcgctcc       180
     tgcagcagtt ttgccctcga tcgcggccac tggcagcggt tgcgccctgg ggcgccggtg       240
     cccacatga                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page