(data stored in ACNUC29543 zone)

EMBL: CT978603.PE258

CT978603.PE258       Location/Qualifiers
FT   CDS_pept        complement(256491..256754)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0258"
FT                   /locus_tag="SynRCC307_0258"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27161"
FT                   /db_xref="InterPro:IPR020885"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQK2"
FT                   /protein_id="CAK27161.1"
FT                   /translation="MFVVELSLKLSPMPISVQRKSLEAAQGLYGEIRQAMESGHPQLMD
FT                   LRCEKSEEKQICLRSSEIVSVQLYEKSAMGAGSKRPGFSTGG"
     atgttcgttg ttgagctgag cctcaagctg tcgccgatgc ctatcagcgt gcagcgcaaa        60
     agcctggaag cggcccaagg cttgtacggc gagattcgcc aagccatgga gtcgggccat       120
     ccccagctaa tggatctgcg ctgcgaaaaa tcagaggaaa aacagatctg cctgcgcagc       180
     agtgaaatcg tttcggtgca gctgtatgaa aagagcgcca tgggtgccgg cagcaagcgt       240
     cctggcttca gcaccggcgg ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page