(data stored in ACNUC29543 zone)

EMBL: CT978603.PE272

CT978603.PE272       Location/Qualifiers
FT   CDS_pept        complement(274112..275284)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0272"
FT                   /locus_tag="SynRCC307_0272"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27175"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL6"
FT                   /protein_id="CAK27175.1"
FT                   /translation="MQLLLLSNGHGEDLSGARLGQALQQQGASVRAVPLVGDGAPYRQA
FT                   ELPIAGRTQSFSTGGLGYASFAGRLKEIVQGQVLYLLKRSWRLLQEARHADGIVVVGDV
FT                   IPVILAWLSGKPVITYLVAYSSHYEGRLRLPWPCGPCLASKRFAAVFSRDALSASDLSE
FT                   QLGRPVEFLGNPFMDGLVALDASERSGRVLLLPGSRLPEARQNLERMLALLEELPAGLR
FT                   HHDFQAALVRELPAAAVEALAASRGWSLSSSTSRSLWLKRKGLVLQCCWGQFTTLLPAA
FT                   QVVVSMAGTASEQAVGLGKPVLQLAGHGPQFTVGFAEAQRRLLGPGVHCAEGDVDDPHT
FT                   LIASADLLEQLLQLPEATLQQLREEGDQRLGQAGGTKRMARAILERLQHA"
     atgcagctac tgctgctcag caacggccac ggggaagacc tcagtggagc ccgtcttggg        60
     caagcgctgc agcagcaggg tgcttcggtg cgagccgtgc ctttggtggg cgatggagcc       120
     ccctaccggc aggccgaact gccgatcgca ggccgcaccc agagcttcag caccggcggg       180
     ctgggctacg ccagctttgc cggccgctta aaagaaatcg tgcaagggca ggtgctttat       240
     ctgctcaagc gcagctggcg gctgctgcaa gaagcgcgcc acgccgatgg aatcgttgtg       300
     gtgggcgatg tgatcccggt gatcctggcc tggctgagcg gcaagccggt gatcacctat       360
     ctggtggcct actccagcca ttacgaaggc cgtctgcggc tgccgtggcc ctgcgggcca       420
     tgcctggcca gcaaacgctt tgccgcggtg ttcagccgcg atgcgctgag cgccagtgat       480
     ctgagcgagc aattggggcg gccggtggag tttctcggca atccattcat ggatggcttg       540
     gtggcccttg atgccagcga gcgctccggg cgggtgctgc tgctgcccgg cagccgtctg       600
     ccagaagcgc gccaaaacct cgagcgcatg ctggcgttat tggaagaact acccgctggg       660
     ttgcgccacc acgatttcca ggcggcgttg gtgcgcgaac tgcccgcagc cgcagtggaa       720
     gccttggccg ccagccgcgg ctggagcttg agcagcagca ccagccgcag cctctggctc       780
     aagcgcaaag ggctggtgct gcagtgctgc tgggggcaat tcaccaccct gctgccagcg       840
     gcgcaggtgg tggtgtcgat ggcgggcacc gccagcgaac aggccgttgg tttgggcaag       900
     ccggtgctgc aactcgccgg ccatggcccg caattcaccg tgggctttgc cgaagcccaa       960
     cggcgcttgt tgggcccggg ggtgcattgc gccgaaggcg atgtggatga cccgcacacc      1020
     ctgatcgcca gcgctgattt actggagcag ttgctgcagc tgccggaggc aacactgcag      1080
     cagctgcgcg aagagggaga tcaacgctta ggccaagccg gcggcaccaa gcgcatggcc      1140
     cgcgcgatcc tggagaggct gcaacacgcg taa                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page