(data stored in ACNUC29543 zone)

EMBL: CT978603.PE273

CT978603.PE273       Location/Qualifiers
FT   CDS_pept        complement(275286..275717)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0273"
FT                   /locus_tag="SynRCC307_0273"
FT                   /product="TPR-repeat protein, specific for cyanobacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27176"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQL7"
FT                   /protein_id="CAK27176.1"
FT                   /translation="MTEEQPSLSESQFGQALQRYQDGAEAADVIADFEAITRRDPRQAA
FT                   GWTCLAWLQLLTEQPEDALRSAKTAVKLNAQDPQGRLNLALAMLETGAKGVREHIEIVK
FT                   RVMVFSPELGQELEASIADGLQRRPGWPALLKVQAWLAD"
     atgacggaag agcagccaag cctgagcgaa agtcaattcg gccaagccct gcagcgctac        60
     caagacggcg ctgaggccgc cgatgtgatc gcggacttcg aggccatcac ccggcgcgac       120
     ccgcgtcagg ccgccggctg gacctgcctg gcatggctgc aattgctgac cgagcagccc       180
     gaagacgccc tgcgctcagc caaaactgcg gtgaaactca acgcgcaaga tccgcaaggg       240
     cggctgaatt tggccctggc gatgctggaa accggcgcca aaggcgtgcg tgagcacatc       300
     gagatcgtca agcgcgtgat ggtgttctcc ccggaactgg gccaagagct ggaggcctcg       360
     atcgccgatg ggctccagcg gcggccgggt tggccagcac tgctgaaagt gcaggcctgg       420
     ctggcggact ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page