(data stored in ACNUC29543 zone)

EMBL: CT978603.PE279

CT978603.PE279       Location/Qualifiers
FT   CDS_pept        complement(279431..280627)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0279"
FT                   /locus_tag="SynRCC307_0279"
FT                   /product="Glycosyltransferase of family GT2; modular;
FT                   contains a TPR-repeat domain"
FT                   /note="Cell envelope biogenesis, outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27182"
FT                   /db_xref="GOA:A5GQM3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQM3"
FT                   /protein_id="CAK27182.1"
FT                   /translation="MLSLSMIVRDEEQQLGACLESVKGFCDELVVVDTGSTDNTVAIAK
FT                   DAGARVEEIEWPGDFTPARNKALEFVSGEWVLVLDADELLLDDVKPALQALMAQPDVLV
FT                   INLLRYEDGAVQSPYSSVSRLFRKHPAIQWSRAYHSMIDDSVEELLKSESQWRVVDCAE
FT                   PALFHTGYRPEELIAGNKANRLREAMEAELASKPGDPYACAKLGGLEVDQGNTTRGLAL
FT                   LEMGLEHCQSDQHRERYELLLHLGIANSSNKPEEAERYYRLALEEPLSPQVLVGARLNL
FT                   GALLLRLNKLAEATEVTSAVTRQLPEVMLGWYNLGLIQRKAGDIGGAIEAYQSGLQLDP
FT                   NSPELHQNLGAAQLAGGNFEAARSSFLMAIGLLLQQNRKDDAEALARSAGELVNLNAA"
     atgctcagcc tctcgatgat cgtgcgcgat gaggagcagc agctcggcgc ttgcctcgag        60
     agcgtgaaag ggttctgcga tgaactggtg gttgttgaca ccggctccac cgacaacacc       120
     gtcgccattg ccaaagacgc cggagcacga gtcgaagaaa tcgaatggcc cggcgatttc       180
     accccagcgc gcaacaaggc gttggagttc gtcagcggcg agtgggtgct ggtgctcgat       240
     gccgatgagc tgctgcttga tgacgtcaag ccggcgctgc aagcgttgat ggcgcagccc       300
     gatgtgctgg tgatcaacct gctgcgctac gaggacggcg cggtgcaatc gccctactcc       360
     agcgtcagcc gcctgttccg caagcaccct gcgatccaat ggagccgggc ctatcactcg       420
     atgatcgacg actccgtcga ggagctgctc aaaagcgaga gccaatggcg cgttgttgat       480
     tgcgctgaac cggccctgtt ccacaccggc taccgccccg aagagctcat cgccggcaac       540
     aaggccaacc gtctgcggga ggccatggaa gccgagctcg ccagcaaacc cggcgacccc       600
     tatgcctgcg ccaagctcgg cggccttgag gtggatcaag gcaacaccac ccgcggcttg       660
     gccctgctgg agatgggact cgagcactgc caaagcgatc aacaccgcga gcgctatgag       720
     ctgctgctgc acctgggcat cgccaacagc agcaataaac ctgaggaagc cgagcgctac       780
     taccgcctgg ccttggagga acccctcagt ccccaggtgc tggtgggagc ccggctcaac       840
     ctcggggcat tgctgctgcg cctgaacaag ctggcggaag ccaccgaggt gacctcagcg       900
     gtgacccggc agctgccgga ggtgatgctg ggctggtaca acctcggcct gatccaacgc       960
     aaagccggcg acatcggcgg ggcgatcgag gcctaccaaa gcggtttgca gcttgatccc      1020
     aacagcccag agctgcatca aaacctggga gccgcccagc tggctggcgg caactttgaa      1080
     gcggcgcgca gcagcttttt gatggcgatt gggctgctgc tgcagcaaaa ccgcaaagat      1140
     gatgctgaag ccttggcccg cagcgctggc gagctggtga acctgaatgc cgcctga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page