(data stored in ACNUC29543 zone)

EMBL: CT978603.PE288

CT978603.PE288       Location/Qualifiers
FT   CDS_pept        complement(286889..287590)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0288"
FT                   /locus_tag="SynRCC307_0288"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27191"
FT                   /db_xref="GOA:A5GQN2"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN2"
FT                   /protein_id="CAK27191.1"
FT                   /translation="MQQQPISIFIGMDPRERAATNVLIDSLVDTSSAPLAITPLVTPQL
FT                   EQQKLYWRQRDPKQSTAFSFTRFLVPQLMGFQGWAIFMDCDMLCRADISDLWALRDERF
FT                   AVMCVQHDHQPTEASKFLGETQSAYPKKNWSSLMLLNCSRCQALTPEYVNSASGLDLHR
FT                   FHWLDGDHQIGALPNRWNHLVGVQEPASEEAALLHWTLGGPWFRGQRSMGGTVAAEWFG
FT                   ARDDAMALWDE"
     atgcagcagc agcccatctc gatcttcatt ggcatggacc cgcgcgagcg ggccgccacc        60
     aatgtgttga tcgattcgct tgtggacacg agcagcgcgc cgcttgccat cacgcctcta       120
     gtgacccccc agctggagca gcaaaagctc tattggcgcc agcgcgaccc caaacaaagc       180
     accgcgttct ccttcactcg ctttttggtg ccccagctga tgggctttca aggctgggcg       240
     atctttatgg actgcgacat gctctgccgc gctgacatca gcgacctatg ggcgcttcgt       300
     gatgagcgct ttgccgtgat gtgcgtgcaa cacgatcacc aacccacaga agccagcaag       360
     ttcttgggag aaacccaaag cgcctacccc aaaaaaaact ggagctcatt aatgctgctg       420
     aactgcagcc gctgccaagc actcacaccg gaatacgtga actcagcaag cgggcttgat       480
     ctgcatcgct tccattggct cgacggcgac catcagatcg gtgccctacc caaccgctgg       540
     aatcacttgg tgggtgtgca agaaccagcc agcgaggagg cggccctgct gcattggacc       600
     cttggggggc cctggtttcg cgggcagcgc agcatgggcg ggactgtcgc ggccgaatgg       660
     tttggcgccc gtgatgacgc catggccctg tgggacgaat ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page