(data stored in ACNUC29543 zone)

EMBL: CT978603.PE290

CT978603.PE290       Location/Qualifiers
FT   CDS_pept        288293..288571
FT                   /transl_table=11
FT                   /gene="SynRCC307_0290"
FT                   /locus_tag="SynRCC307_0290"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27193"
FT                   /db_xref="InterPro:IPR021954"
FT                   /db_xref="InterPro:IPR038150"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN4"
FT                   /protein_id="CAK27193.1"
FT                   /translation="MSPSRLVAMSDPLIRELDHYVVLDPAVGEQILSAAETRHWLAEQL
FT                   QRLKQLPADIAAVEGLPQQVEWLIDTACALEIEPGLTVQWFAVRLEP"
     atgagcccca gcaggctggt ggccatgtct gatcccctca tccgtgagct tgatcattac        60
     gtggtgctgg atccagccgt gggcgaacaa atcctcagcg cggccgaaac ccgtcactgg       120
     ttggcggagc agctccaacg cctcaagcaa ttgccggccg acatcgctgc tgtcgagggt       180
     ctgccccagc aggtggaatg gctcatcgac acggcctgtg cgctggaaat cgagccaggg       240
     ctcacggtgc agtggtttgc ggtgcgcctg gagccttga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page