(data stored in ACNUC29543 zone)

EMBL: CT978603.PE294

CT978603.PE294       Location/Qualifiers
FT   CDS_pept        complement(290667..291014)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0294"
FT                   /locus_tag="SynRCC307_0294"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27197"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQN8"
FT                   /protein_id="CAK27197.1"
FT                   /translation="MLLPLLILAQTSTPTEDLLMVLRPQLELQMTRECEKAVNSPDGSF
FT                   LNLRSICSEISQPASVCLVEEISQQGSLAQVAREALEGSLGPASLGVASACIERLMQSA
FT                   KPVWDQEFPLR"
     atgctgctgc ccttactgat cctggctcaa accagcacgc cgaccgaaga cctgttgatg        60
     gtgctgcggc cgcagctgga gctgcagatg acgcgggaat gcgaaaaagc cgtcaacagc       120
     cctgacggca gcttcttgaa tctgcgcagc atctgctcag agatctcaca acccgccagc       180
     gtttgcctgg tggaggagat cagccagcaa ggcagcttgg cccaagtggc ccgtgaagct       240
     cttgaaggca gcctggggcc cgccagcttg ggtgtggctt cggcctgcat cgaacggctg       300
     atgcaaagcg ccaagccggt gtgggatcag gagttcccct tgcgctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page